2RVL: Chromobox protein homolog 5

Solution structure of the chromodomain of HP1alpha with the N-terminal tail. Determined by solution NMR. Released 16 Mar 2016.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 687
Mol. weight: 9.85 kDa
Released: 16 Mar 2016

Explore 2RVL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2RVL contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	22-31	10	1
β-strand	34-41	8	1
α-helix	46-48	3
β-strand	51-53	3	1
α-helix	60-73	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox protein homolog 5	A	protein	83	Mus musculus	Q61686 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2RVL_1 Chromobox protein homolog 5 (chains A)
GSHMGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNL
DCPELISEFMKKYKKMKEGENNK

Primary citation

Extended string-like binding of the phosphorylated HP1 alpha N-terminal tail to the lysine 9-methylated histone H3 tail. Shimojo, H., Kawaguchi, A., Oda, T. et al. Sci Rep (2016) 6:22527-22527. DOI 10.1038/srep22527 · PubMed

Other PDB entries of the same protein (UniProt Q61686 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2RVM Solution structure of the chromodomain of HP1alpha with the phosphorylated N-terminal tail
2RVN Solution structure of the chromodomain of HP1a with the phosphorylated N-terminal tail…

Browse structure collections

About this viewer

MolViewer shows 2RVL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.