N-terminal domain of tissue inhibitor of metalloproteinase-2 (N-timp-2), NMR, 49 structures. Determined by solution NMR. Released 9 Dec 1998.
Explore 2TMP in 3D Show helices and sheets RCSB PDB PDBe
2TMP contains 0 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18 | 1 | 1 |
| β-strand | 23 | 1 | 2 |
| β-strand | 33 | 1 | 3 |
| β-strand | 39 | 1 | 3 |
| β-strand | 44-46 | 3 | 4 |
| β-strand | 47 | 1 | 2 |
| β-strand | 62-64 | 3 | 4 |
| β-strand | 87 | 1 | 1 |
| β-strand | 97 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tissue inhibitor of metalloproteinases-2 | A | protein | 127 | Homo sapiens | P16035 (AlphaFold model) |
>2TMP_1 TISSUE INHIBITOR OF METALLOPROTEINASES-2 (chains A) CSCSPVHPQQAFCNADVVIRTKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDI EFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNH RYQMGCE
High resolution structure of the N-terminal domain of tissue inhibitor of metalloproteinases-2 and characterization of its interaction site with matrix metalloproteinase-3. Muskett, F.W., Frenkiel, T.A., Feeney, J. et al. J Biol Chem (1998) 273:21736-21743. DOI 10.1074/jbc.273.34.21736 · PubMed
Other PDB entries of the same protein (UniProt P16035 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2TMP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.