1.4 a resolution structure of mouse tumor necrosis factor, towards modulation of its selectivity and trimerisation. Determined by X-ray diffraction at 1.4 Å resolution. Released 12 Oct 1999.
Explore 2TNF in 3D Show helices and sheets RCSB PDB PDBe
2TNF contains 5 α-helices and 36 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-18 | 6 | 1 |
| β-strand | 28-29 | 2 | 1 |
| β-strand | 36-38 | 3 | 1 |
| β-strand | 42-44 | 3 | 2 |
| β-strand | 47-49 | 3 | 2 |
| β-strand | 54-67 | 14 | 1 |
| β-strand | 76-83 | 8 | 2 |
| β-strand | 90-98 | 9 | 2 |
| β-strand | 113-126 | 14 | 1 |
| β-strand | 131-136 | 6 | 2 |
| α-helix | 139-141 | 3 | |
| β-strand | 142 | 1 | 1 |
| β-strand | 151-156 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-18 | 6 | 3 |
| β-strand | 28-29 | 2 | 3 |
| β-strand | 36-38 | 3 | 3 |
| β-strand | 42-44 | 3 | 4 |
| β-strand | 47-49 | 3 | 4 |
| β-strand | 54-67 | 14 | 3 |
| β-strand | 76-83 | 8 | 4 |
| β-strand | 91-98 | 8 | 4 |
| α-helix | 111-112 | 2 | |
| β-strand | 113-126 | 14 | 3 |
| β-strand | 131-136 | 6 | 4 |
| α-helix | 139-141 | 3 | |
| β-strand | 142 | 1 | 3 |
| β-strand | 151-156 | 6 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-12 | 3 | |
| β-strand | 13-18 | 6 | 5 |
| β-strand | 28-29 | 2 | 5 |
| β-strand | 36-38 | 3 | 5 |
| β-strand | 42-44 | 3 | 6 |
| β-strand | 47-49 | 3 | 6 |
| β-strand | 54-67 | 14 | 5 |
| β-strand | 76-83 | 8 | 6 |
| β-strand | 91-98 | 8 | 6 |
| β-strand | 113-126 | 14 | 5 |
| β-strand | 131-136 | 6 | 6 |
| α-helix | 139-141 | 3 | |
| β-strand | 142 | 1 | 5 |
| β-strand | 151-156 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (tumor necrosis factor alpha) | A, B, C | protein | 156 | Mus musculus | P06804 (AlphaFold model) |
>2TNF_1 PROTEIN (TUMOR NECROSIS FACTOR ALPHA) (chains A, B, C) LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLG GVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
| ID | Name | Formula | Copies |
|---|---|---|---|
| IPA | Isopropyl alcohol | C3 H8 O | 1 |
Water and common crystallization additives (TRS) are not listed.
The structure of mouse tumour-necrosis factor at 1.4 A resolution: towards modulation of its selectivity and trimerization. Baeyens, K.J., De Bondt, H.L., Raeymaekers, A. et al. Acta Crystallogr D Biol Crystallogr (1999) 55:772-778. DOI 10.1107/S0907444998018435 · PubMed
Other PDB entries of the same protein (UniProt P06804 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2TNF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.