2UUR: N-terminal NC4 domain of collagen IX

N-terminal NC4 domain of collagen IX. Determined by X-ray diffraction at 1.8 Å resolution. Released 5 Jun 2007.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,967
Mol. weight: 27.96 kDa
Ligands: ZN
Released: 5 Jun 2007

Explore 2UUR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2UUR contains 8 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	33-35	3	1
α-helix	36-39	4
α-helix	42-46	5
β-strand	53-55	3	1
β-strand	62-66	5	1
β-strand	73-75	3	2
α-helix	76-79	4
β-strand	88-95	8	1
α-helix	98-102	5
β-strand	104-111	8	2
β-strand	117-124	8	2
α-helix	125-127	3
β-strand	129-135	7	2
β-strand	136	1	3
β-strand	141-146	6	2
α-helix	150-152	3
β-strand	158-164	7	1
β-strand	168-173	6	1
β-strand	176-182	7	1
α-helix	184-185	2
β-strand	186	1	3
β-strand	194-200	7	2
β-strand	207	1	2
β-strand	210-218	9	1
α-helix	223-226	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Collagen alpha-1(IX) chain	A	protein	245	HOMO SAPIENS	P20849 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2UUR_1 COLLAGEN ALPHA-1(IX) CHAIN (chains A)
AVKRRPRFPVNSNSNGGNELCPKIRIGQDDLPGFDLISQFQVDKAASRRAIQRVVGSATL
QVAYKLGNNVDFRIPTRNLYPSGLPEEYSFLTTFRMTGSTLKKNWNIWQIQDSSGKEQVG
IKINGQTQSVVFSYKGLDGSLQTAAFSNLSSLFDSQWHKIMIGVERSSATLFVDCNRIES
LPIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQ
TTDER

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (EDO, SO4) are not listed.

Primary citation

Crystal Structure of the N-Terminal Nc4 Domain of Collagen Ix, a Zinc Binding Member of the Laminin-Neurexin-Sex Hormone Binding Globulin (Lns) Domain Family. Leppanen, V.-M., Tossavainen, H., Permi, P. et al. J Biol Chem (2007) 282:23219. DOI 10.1074/JBC.M702514200 · PubMed

Other PDB entries of the same protein (UniProt P20849 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CTD 1.6 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…
5CTI 1.9 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…
5CVA 2.1 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…
5CVB 2.25 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…

Browse structure collections

About this viewer

MolViewer shows 2UUR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.