2UVL: Baculoviral iap repeat-containing protein 3

Human BIR3 domain of Baculoviral Inhibitor of Apoptosis Repeat- Containing 3 (BIRC3). Determined by X-ray diffraction at 1.91 Å resolution. Released 27 Mar 2007.

Method: X-ray diffraction
Resolution: 1.91 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,668
Mol. weight: 22.46 kDa
Ligands: ZN
Released: 27 Mar 2007

Explore 2UVL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2UVL contains 14 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	243-244	2	1
α-helix	250-252	3
α-helix	255-260	6
α-helix	261-264	4
α-helix	273-278	6
β-strand	281-285	5	2
β-strand	289-292	4	2
β-strand	298-300	3	2
α-helix	302-303	2
α-helix	308-315	8
α-helix	320-334	15

Chain B: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	243-244	2	2
α-helix	247-248	2
α-helix	249-252	4
α-helix	255-260	6
α-helix	261-264	4
α-helix	273-278	6
β-strand	281-283	3	1
β-strand	290-292	3	1
β-strand	298-300	3	1
α-helix	308-315	8
α-helix	320-335	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral iap repeat-containing protein 3	A, B	protein	96	HOMO SAPIENS	Q13489 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2UVL_1 BACULOVIRAL IAP REPEAT-CONTAINING PROTEIN 3 (chains A, B)
SMRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRC
WESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQAS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structures of Bir Domains from Human Naip and Ciap2. Herman, M.D., Moche, M., Flodin, S. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2009) 65:1091. DOI 10.1107/S1744309109038597 · PubMed

Other PDB entries of the same protein (UniProt Q13489 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EB5 2.0 Å, Structure of the cIAP2 RING domain
3M0A 2.61 Å, Crystal structure of TRAF2:cIAP2 complex
3M0D 2.8 Å, Crystal structure of the TRAF1:TRAF2:cIAP2 complex
7NK0 3.3 Å, Structure of the BIR1 domain of cIAP2
3EB6 3.4 Å, Structure of the cIAP2 RING domain bound to UbcH5b

Browse structure collections

About this viewer

MolViewer shows 2UVL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.