Non-covalent complex between Ubc9 and SUMO1. Determined by X-ray diffraction at 1.4 Å resolution. Released 12 Jun 2007.
Explore 2UYZ in 3D Show helices and sheets RCSB PDB PDBe
2UYZ contains 13 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-18 | 15 | |
| β-strand | 25-30 | 6 | 1 |
| β-strand | 36-46 | 11 | 1 |
| α-helix | 47-48 | 2 | |
| β-strand | 57-63 | 7 | 1 |
| α-helix | 72-73 | 2 | |
| β-strand | 74-77 | 4 | 1 |
| β-strand | 86 | 1 | 2 |
| β-strand | 91 | 1 | 1 |
| β-strand | 92 | 1 | 2 |
| α-helix | 93 | 1 | |
| α-helix | 95-97 | 3 | |
| α-helix | 109-121 | 13 | |
| α-helix | 131-139 | 9 | |
| α-helix | 141-154 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-27 | 7 | 3 |
| β-strand | 33-39 | 7 | 3 |
| α-helix | 45-55 | 11 | |
| α-helix | 59-61 | 3 | |
| β-strand | 62-66 | 5 | 3 |
| β-strand | 69-70 | 2 | 3 |
| α-helix | 71-72 | 2 | |
| α-helix | 77-80 | 4 | |
| β-strand | 86-92 | 7 | 3 |
| α-helix | 93-94 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sumo-conjugating enzyme UBC9 | A | protein | 158 | MUS MUSCULUS | P63280 (AlphaFold model) |
| Small ubiquitin-related modifier 1 | B | protein | 79 | HOMO SAPIENS | P63165 (AlphaFold model) |
>2UYZ_1 SUMO-CONJUGATING ENZYME UBC9 (chains A) MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKL RMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVSLSILEEDKDWRPAITIKQILLGIQELL NEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
>2UYZ_2 SMALL UBIQUITIN-RELATED MODIFIER 1 (chains B) MEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPK ELGMEEEDVIEVYQEQTGG
Noncovalent interaction between Ubc9 and SUMO promotes SUMO chain formation. Knipscheer, P., van Dijk, W.J., Olsen, J.V. et al. EMBO J (2007) 26:2797-2807. DOI 10.1038/sj.emboj.7601711 · PubMed
Other PDB entries of the same protein (UniProt P63280 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2UYZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.