2V0V: Rev-Erb beta

Crystal Structure of Rev-Erb beta. Determined by X-ray diffraction at 2.4 Å resolution. Released 23 Oct 2007.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 5,810
Mol. weight: 87.78 kDa
Released: 23 Oct 2007

Explore 2V0V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V0V contains 46 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	402-406	5
α-helix	413-422	10
α-helix	431-450	20
α-helix	451-453	3
β-strand	454-455	2	1
β-strand	460-461	2	1
β-strand	462	1	2
β-strand	468	1	2
α-helix	482-495	14
α-helix	500-511	12
α-helix	516-518	3
α-helix	522-543	22
α-helix	545-550	6
α-helix	552-555	4
α-helix	557-568	12
α-helix	569-571	3

Chain B: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	402-406	5
α-helix	413-422	10
α-helix	431-449	19
α-helix	450-453	4
β-strand	454-455	2	3
β-strand	460-461	2	3
α-helix	474-477	4
α-helix	481-495	15
α-helix	500-511	12
α-helix	522-543	22
α-helix	549-555	7
α-helix	557-568	12
α-helix	570-573	4

Chain C: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	402-406	5
α-helix	413-421	9
α-helix	426-428	3
α-helix	431-449	19
α-helix	451-453	3
β-strand	462-463	2	4
β-strand	467-468	2	4
α-helix	482-493	12
α-helix	500-512	13
α-helix	516-518	3
α-helix	522-543	22
α-helix	549-555	7
α-helix	557-568	12

Chain D: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	403-409	7
α-helix	415-422	8
α-helix	431-449	19
α-helix	450-452	3
α-helix	461	1
β-strand	462-463	2	5
β-strand	467-468	2	5
α-helix	474-477	4
α-helix	481-495	15
α-helix	500-511	12
α-helix	516-518	3
α-helix	522-543	22
α-helix	549-568	20
α-helix	570-573	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Orphan nuclear receptor NR1D2	A, B, C, D	protein	194	HOMO SAPIENS	Q14995 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2V0V_1 ORPHAN NUCLEAR RECEPTOR NR1D2 (chains A, B, C, D)
MSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEV
LMVRFASLFDAKERTVTFLGSKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSL
FTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLN
NMHSEELLAFKVHP

Primary citation

Structural Insight Into the Constitutive Repression Function of the Nuclear Receptor Rev-Erbbeta. Woo, E.-J., Jeong, D.G., Lim, M.-Y. et al. J Mol Biol (2007) 373:735. DOI 10.1016/J.JMB.2007.08.037 · PubMed

Other PDB entries of the same protein (UniProt Q14995 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N73 1.87 Å, Crystal structure of the ligand binding domain (LBD) of REV-ERB beta bound to Cobalt…
3CQV 1.9 Å, Crystal structure of Reverb beta in complex with heme
6WMS 2.0 Å, Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR…
2V7C 2.4 Å, Crystal Structure of Rev-Erb beta
6WMQ 2.55 Å, Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR…

Browse structure collections

About this viewer

MolViewer shows 2V0V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.