2V7C: Rev-Erb beta

Name: PDB 2V7C: Crystal Structure of Rev-Erb beta
Published: 2007-10-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

Crystal Structure of Rev-Erb beta. Determined by X-ray diffraction at 2.4 Å resolution. Released 23 Oct 2007.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,749
Mol. weight: 44.64 kDa
Released: 23 Oct 2007

Explore 2V7C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V7C contains 20 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	407-409	3
α-helix	411-421	11
α-helix	426-428	3
α-helix	431-452	22
β-strand	454-455	2	1
β-strand	460-462	3	1
β-strand	468-469	2	1
α-helix	485-495	11
α-helix	500-511	12
α-helix	522-543	22
α-helix	549-568	20

Chain B: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	401-407	7
α-helix	410-412	3
α-helix	413-422	10
α-helix	426-428	3
α-helix	431-449	19
α-helix	450-453	4
β-strand	454-455	2	2
β-strand	460-462	3	2
β-strand	468-470	3	2
α-helix	471-476	6
α-helix	481-495	15
α-helix	500-512	13
α-helix	516-518	3
α-helix	522-543	22
α-helix	549-568	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Orphan nuclear receptor NR1D2	A, B	protein	194	HOMO SAPIENS	Q14995 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2V7C_1 ORPHAN NUCLEAR RECEPTOR NR1D2 (chains A, B)
MSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQVNLLKAGTFEV
LMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNALQLSDEEMSL
FTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLN
NMHSEELLAFKVHP

Primary citation

Structural Insight Into the Constitutive Repression Function of the Nuclear Receptor Rev-Erbbeta. Woo, E.-J., Jeong, D.G., Lim, M.-Y. et al. J Mol Biol (2007) 373:735. DOI 10.1016/J.JMB.2007.08.037 · PubMed

Other PDB entries of the same protein (UniProt Q14995 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N73 1.87 Å, Crystal structure of the ligand binding domain (LBD) of REV-ERB beta bound to Cobalt…
3CQV 1.9 Å, Crystal structure of Reverb beta in complex with heme
6WMS 2.0 Å, Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR…
2V0V 2.4 Å, Crystal Structure of Rev-Erb beta
6WMQ 2.55 Å, Crystal Structure of Human REV-ERBbeta Ligand Binding Domain Co-Bound to Heme and NCoR…

Browse structure collections

About this viewer

MolViewer shows 2V7C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.