2V7D: 14-3-3 protein zeta

14-3-3 protein zeta in complex with Thr758 phosphorylated integrin beta2 peptide. Determined by X-ray diffraction at 2.5 Å resolution. Released 24 Jun 2008.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: BOS TAURUS, HOMO SAPIENS
Chains: 8
Atoms: 7,645
Mol. weight: 116.21 kDa
Released: 24 Jun 2008

Explore 2V7D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V7D contains 49 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	35-37	3
α-helix	38-67	30
α-helix	74-99	26
α-helix	100-105	6
α-helix	112-115	4
α-helix	117-131	15
α-helix	137-156	20
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-201	17
α-helix	211-226	16

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	35-37	3
α-helix	38-68	31
α-helix	74-100	27
α-helix	101-105	5
α-helix	112-131	20
α-helix	137-156	20
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-201	17
α-helix	211-227	17

Chain C: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	35-37	3
α-helix	38-67	30
α-helix	74-99	26
α-helix	100-105	6
α-helix	112-131	20
α-helix	137-156	20
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-201	17
α-helix	211-227	17

Chain D: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	35-37	3
α-helix	38-67	30
α-helix	74-99	26
α-helix	100-105	6
α-helix	112-131	20
α-helix	137-156	20
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-201	17
α-helix	211-226	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta/delta	A, B, C, D	protein	247	BOS TAURUS	P63103 (AlphaFold model)
Integrin beta chain, beta 2 variant	P, Q, R, S	protein	10	HOMO SAPIENS	P05107 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2V7D_1 14-3-3 PROTEIN ZETA/DELTA (chains A, B, C, D)
GSMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSS
WRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFY
LKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAE
AGEGGEN

Sequence of entity 2 (P, Q, R, S), FASTA

>2V7D_2 INTEGRIN BETA CHAIN, BETA 2 VARIANT (chains P, Q, R, S)
KSATTTVMNP

Primary citation

Beta2 Integrin Phosphorylation on Thr758 Acts as a Molecular Switch to Regulate 14-3-3 and Filamin Binding. Takala, H., Nurminen, E., Nurmi, S.M. et al. Blood (2008) 112:1853. DOI 10.1182/BLOOD-2007-12-127795 · PubMed

Other PDB entries of the same protein (UniProt P63103 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A4O 2.8 Å, 14-3-3 protein zeta isoform
1A38 3.35 Å, 14-3-3 protein zeta bound to R18 peptide
1A37 3.6 Å, 14-3-3 protein zeta bound to ps-RAF259 peptide

Browse structure collections

About this viewer

MolViewer shows 2V7D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.