2V7H: Monoclonal antibody

Crystal structure of an immunogen specific anti-mannopyranoside monoclonal antibody Fab fragment. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 Aug 2008.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: MUS MUSCULUS
Chains: 4
Atoms: 6,704
Mol. weight: 94.84 kDa
Released: 19 Aug 2008

Explore 2V7H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2V7H contains 19 α-helices and 93 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	10-14	5	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	44-48	5	2
β-strand	62-67	6	1
β-strand	70-75	6	1
β-strand	85-90	6	2
β-strand	97-98	2	2
β-strand	103-107	5	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	159-163	5	4
α-helix	165-167	3
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-197	7	5
β-strand	205-210	6	5

Chain B: 3 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	6
β-strand	11-12	2	7
β-strand	18-25	8	6
β-strand	34-40	7	8
β-strand	44-51	8	8
β-strand	59	1	8
β-strand	68-71	4	6
β-strand	78-83	6	6
β-strand	92-99	8	8
α-helix	100	1
β-strand	108-111	4	8
β-strand	115-117	3	8
β-strand	118-119	2	7
β-strand	125	1	9
α-helix	126-127	2
β-strand	128-132	5	10
β-strand	143-153	11	10
β-strand	154	1	9
β-strand	159-162	4	11
β-strand	167	1	11
β-strand	171-173	3	10
β-strand	177-178	2	10
β-strand	183-192	10	10
β-strand	202-207	6	11
α-helix	208-210	3
β-strand	212-217	6	11

Chain H: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	20
β-strand	11-12	2	21
β-strand	18-25	8	20
α-helix	29-31	3
β-strand	33-40	8	22
β-strand	44-51	8	22
β-strand	58-60	3	22
β-strand	65	1	23
β-strand	68	1	23
β-strand	70-71	2	20
β-strand	78-83	6	20
α-helix	88-90	3
β-strand	92-99	8	22
β-strand	108-111	4	22
β-strand	115-117	3	22
β-strand	118-119	2	21
α-helix	126-127	2
β-strand	128-132	5	24
β-strand	144-146	3	25
β-strand	147-153	7	24
β-strand	159-162	4	26
α-helix	163-165	3
β-strand	167	1	26
β-strand	171-173	3	25
α-helix	174-176	3
β-strand	177-178	2	24
β-strand	183-186	4	24
β-strand	187-191	5	25
α-helix	195-198	4
α-helix	200	1
β-strand	201-207	7	26
α-helix	208-210	3
β-strand	212-218	7	26

Chain L: 4 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	12
β-strand	10-13	4	13
β-strand	19-25	7	12
β-strand	33-39	7	13
β-strand	43-48	6	13
β-strand	49	1	14
β-strand	54	1	14
β-strand	64-67	4	12
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	85-90	6	13
β-strand	98	1	13
β-strand	102-106	5	13
β-strand	111	1	15
β-strand	114-118	5	16
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-132	4	17
β-strand	133-139	7	16
β-strand	140	1	15
β-strand	144-150	7	18
β-strand	159-160	2	17
β-strand	163	1	16
β-strand	173-176	4	16
β-strand	178-182	5	17
α-helix	183-186	4
β-strand	192-198	7	18
β-strand	199	1	19
β-strand	201	1	19
β-strand	205-209	5	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monoclonal antibody	A, L	protein	214	MUS MUSCULUS	P01647 (AlphaFold model), P01837 (AlphaFold model)
Monoclonal antibody	B, H	protein	220	MUS MUSCULUS

Sequence of entity 1 (A, L), FASTA

>2V7H_1 MONOCLONAL ANTIBODY (chains A, L)
DIQMTQTTSSLSASLGDRVTISCRASQDINNYLNWYQQKPDGTVKILIYYTSNLHSGVPS
RFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSARQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B, H), FASTA

>2V7H_2 MONOCLONAL ANTIBODY (chains B, H)
QAQLQQSGAELMKPGASVKISCKATGYTFSNYWIDWIKQRPGHGLEWIGEILPGSGSTNY
NEKFRGKATFTADTSSNTAYMQLSSLTSEDSAVYYCTRRGYWAYDFDYWGQGTTLTVSSA
KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD

Primary citation

Role of Antibody Paratope Conformational Flexibility in the Manifestation of Molecular Mimicry. Krishnan, L., Sahni, G., Kaur, K.J. et al. Biophys J (2008) 94:1367. DOI 10.1529/BIOPHYSJ.107.108654 · PubMed

Other PDB entries of the same protein (UniProt P01647 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U0W 2.0 Å, AD related murine antibody Fragment
1EZV 2.3 Å, Structure of the yeast cytochrome BC1 complex co-crystallized with an antibody fv-fragment
4PD4 3.04 Å, Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular…
2VWE 3.4 Å, Crystal Structure of Vascular Endothelial Growth Factor-B in Complex with a Neutralizing…

Browse structure collections

About this viewer

MolViewer shows 2V7H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.