Mouse Profilin IIa in complex with the proline-rich domain of VASP. Determined by X-ray diffraction at 1.98 Å resolution. Released 18 Dec 2007.
Explore 2V8C in 3D Show helices and sheets RCSB PDB PDBe
2V8C contains 10 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-11 | 10 | |
| β-strand | 16-23 | 8 | 1 |
| β-strand | 29-33 | 5 | 1 |
| α-helix | 39-41 | 3 | |
| α-helix | 44-51 | 8 | |
| α-helix | 57-61 | 5 | |
| β-strand | 63-65 | 3 | 1 |
| β-strand | 68-76 | 9 | 1 |
| β-strand | 84-89 | 6 | 1 |
| α-helix | 90-91 | 2 | |
| α-helix | 95-97 | 3 | |
| β-strand | 99-104 | 6 | 1 |
| β-strand | 108-114 | 7 | 1 |
| α-helix | 115 | 1 | |
| α-helix | 120-136 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-5 | 4 | |
| α-helix | 8-12 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Profilin-2 | A | protein | 140 | MUS MUSCULUS | Q9JJV2 (AlphaFold model) |
| Vasodilator-stimulated phosphoprotein | C | protein | 20 | MUS MUSCULUS | P70460 (AlphaFold model) |
>2V8C_1 PROFILIN-2 (chains A) MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF
>2V8C_2 VASODILATOR-STIMULATED PHOSPHOPROTEIN (chains C) GPPPPPGPPPPPGPPPPPGL
| ID | Name | Formula | Copies |
|---|---|---|---|
| IPA | Isopropyl alcohol | C3 H8 O | 2 |
Water and common crystallization additives (SO4, NA, GOL) are not listed.
High-Resolution Structural Analysis of Mammalian Profilin 2A Complex Formation with Two Physiological Ligands: The Formin Homology 1 Domain of Mdia1 and the Proline-Rich Domain of Vasp. Kursula, P., Kursula, I., Massimi, M. et al. J Mol Biol (2008) 375:270. DOI 10.1016/J.JMB.2007.10.050 · PubMed
Other PDB entries of the same protein (UniProt Q9JJV2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2V8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.