2VGE: C-terminal region of human iASPP

Crystal structure of the C-terminal region of human iASPP. Determined by X-ray diffraction at 2.1 Å resolution. Released 5 Feb 2008.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,746
Mol. weight: 25.31 kDa
Released: 5 Feb 2008

Explore 2VGE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VGE contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	620-622	3
α-helix	627-637	11
α-helix	640-649	10
α-helix	663-669	7
α-helix	673-681	9
α-helix	696-702	7
α-helix	706-713	8
α-helix	731-733	3
α-helix	741-754	14
α-helix	759-761	3
β-strand	762-765	4	1
β-strand	769	1	2
β-strand	776	1	1
β-strand	779	1	2
β-strand	784-789	6	1
β-strand	798-803	6	1
β-strand	806-811	6	1
α-helix	812-814	3
β-strand	815-816	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rela-associated inhibitor	A	protein	229	HOMO SAPIENS	Q8WUF5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2VGE_1 RELA-ASSOCIATED INHIBITOR (chains A)
MRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHN
AICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIFATTLSD
GATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFREGESVT
VLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKVKHHHHHH

Primary citation

Biochemical and Structural Studies of Aspp Proteins Reveal Differential Binding to P53, P63 and P73. Robinson, R.A., Lu, X., Jones, E.Y. et al. Structure (2008) 16:259. DOI 10.1016/J.STR.2007.11.012 · PubMed

Other PDB entries of the same protein (UniProt Q8WUF5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HL6 1.97 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and iASPP(670-693)
9GFO 2.4 Å, iASPP-CTD fusion to p63 peptide
6DCX 3.41 Å, iASPP-PP-1c structure and targeting of p53
6RZ3 4.23 Å, Crystal structure of a complex between the DNA-binding domain of p53 and the…

Browse structure collections

About this viewer

MolViewer shows 2VGE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.