2VIU: Influenza virus hemagglutinin

Name: PDB 2VIU: Influenza virus hemagglutinin
Published: 1998-04-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hemagglutinin

Influenza virus hemagglutinin. Determined by X-ray diffraction at 2.5 Å resolution. Released 29 Apr 1998.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Influenza A virus (A/X-31(H3N2)), unidentified influenza virus
Chains: 2
Atoms: 4,104
Mol. weight: 57.98 kDa
Ligands: NAG
Released: 29 Apr 1998

Explore 2VIU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VIU contains 12 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	11-17	7	1
β-strand	18-19	2	2
β-strand	24-26	3	3
β-strand	34-36	3	3
β-strand	39-41	3	4
β-strand	43-44	2	5
β-strand	51-54	4	6
β-strand	58-60	3	7
α-helix	66-71	6
α-helix	74-79	6
β-strand	83	1	8
β-strand	86-89	4	7
β-strand	100-101	2	9
α-helix	105-115	11
β-strand	117	1	8
β-strand	120-122	3	9
β-strand	130-131	2	10
β-strand	136-141	6	11
β-strand	144-146	3	11
β-strand	151-153	3	9
β-strand	155-156	2	10
β-strand	157	1	12
β-strand	160	1	12
β-strand	164-169	6	13
β-strand	176-184	9	9
α-helix	188-195	8
β-strand	201-205	5	13
β-strand	210-213	4	13
β-strand	223	1	14
β-strand	226	1	14
β-strand	229-237	9	9
β-strand	242-249	8	13
β-strand	251-254	4	9
β-strand	256-259	4	9
β-strand	266-269	4	7
α-helix	272-273	2
β-strand	274-278	5	6
β-strand	281-283	3	15
β-strand	286-288	3	15
β-strand	294-295	2	5
β-strand	302-304	3	15
α-helix	306	1
β-strand	307-308	2	5
β-strand	315-317	3	4
β-strand	321	1	3

Chain B: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	16
β-strand	10	1	16
β-strand	14-15	2	2
β-strand	22-28	7	1
β-strand	31-37	7	1
α-helix	38-55	18
α-helix	59-60	2
β-strand	61-62	2	15
α-helix	76-126	51
α-helix	127-129	3
β-strand	130-132	3	1
β-strand	137-140	4	1
α-helix	146-153	8
α-helix	159-170	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hemagglutinin	A	protein	328	Influenza A virus (A/X-31(H3N2))	P03437
Hemagglutinin	B	protein	175	unidentified influenza virus	P03437

Sequence of entity 1 (A), FASTA

>2VIU_1 HEMAGGLUTININ (chains A)
QDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILD
GIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEF
ITEGFTWTGVIQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIW
GIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPG
DVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKI
TYGACPKYVKQNTLKLATGMRNVPEKQT

Sequence of entity 2 (B), FASTA

>2VIU_2 HEMAGGLUTININ (chains B)
GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTN
EKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFE
KTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKG

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

Antigen distortion allows influenza virus to escape neutralization. Fleury, D., Wharton, S.A., Skehel, J.J. et al. Nat Struct Biol (1998) 5:119-123. DOI 10.1038/nsb0298-119 · PubMed

Other PDB entries of the same protein (UniProt P03437), best resolution first:

8PJF 1.48 Å, Human Leukocyte Antigen class II allotype DR1 presenting P11T->R modified influenza A…
8PJE 1.7 Å, Human Leukocyte Antigen class II allotype DR1 presenting influenza A virus…
8PJG 1.83 Å, F11 TCR in complex with Human Leukocyte Antigen class II allotype DR1 presenting P11T->R…
1QU1 1.9 Å, Crystal structure of EHA2 (23-185)
6E56 2.0 Å, Human antibody H2214 in complex with influenza hemagglutinin A/Aichi/2/1968 (X-31) (H3N2)
1PYW 2.1 Å, Human class II MHC protein HLA-DR1 bound to a designed peptide related to influenza…
3S5L 2.1 Å, Crystal structure of CD4 mutant bound to HLA-DR1
1J8H 2.4 Å, Crystal Structure of a Complex of a Human alpha/beta-T cell Receptor, Influenza HA…
3S4S 2.4 Å, Crystal structure of CD4 mutant bound to HLA-DR1
1HTM 2.5 Å, Structure of influenza haemagglutinin at the PH of membrane fusion
6XPX 2.6 Å, Human antibody S1V2-51 in complex with the influenza hemagglutinin head domain of…
1FYT 2.6 Å, Crystal structure of a complex of a human alpha/beta-T cell receptor, influenza ha…

Browse structure collections

About this viewer

MolViewer shows 2VIU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.