2VJ0: Ap-2 complex subunit alpha-2

Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex, in complex with an FXDNF peptide from amphiphysin1 and a WVXF peptide from synaptojanin P170. Determined by X-ray diffraction at 1.6 Å resolution. Released 25 Dec 2007.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: MUS MUSCULUS, HOMO SAPIENS, RATTUS NORVEGICUS
Chains: 3
Atoms: 2,463
Mol. weight: 30.98 kDa
Ligands: DTD, BEN
Released: 25 Dec 2007

Explore 2VJ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VJ0 contains 9 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	695-696	2
β-strand	697	1	1
α-helix	698	1
α-helix	701-706	6
β-strand	714-718	5	2
β-strand	722-731	10	2
β-strand	734-743	10	2
β-strand	749-757	9	1
α-helix	760-765	6
β-strand	766-769	4	2
β-strand	777	1	1
β-strand	782-791	10	2
β-strand	800-807	8	1
β-strand	810-817	8	1
α-helix	822-825	4
β-strand	826-828	3	3
α-helix	833-841	9
α-helix	846-848	3
β-strand	849-855	7	3
α-helix	862-872	11
β-strand	875-876	2	3
β-strand	887-894	8	3
β-strand	899-909	11	3
β-strand	914-921	8	3
α-helix	924-935	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ap-2 complex subunit alpha-2	A	protein	250	MUS MUSCULUS	P17427 (AlphaFold model)
Synaptojanin-1	P	protein	12	HOMO SAPIENS	O43426 (AlphaFold model)
Amphiphysin	Q	protein	7	RATTUS NORVEGICUS	O08838 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2VJ0_1 AP-2 COMPLEX SUBUNIT ALPHA-2 (chains A)
GSPGILAPLAPGSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQ
FLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECISDFTEAPVLNIQFRYG
GTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAK
IIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQ
RLCELLSEQF

Sequence of entity 2 (P), FASTA

>2VJ0_2 SYNAPTOJANIN-1 (chains P)
NPKGWVTFEEEE

Sequence of entity 3 (Q), FASTA

>2VJ0_3 AMPHIPHYSIN (chains Q)
FEDNFVP

Ligands and cofactors

ID	Name	Formula	Copies
DTD	Dithiane diol	C4 H8 O2 S2	1
BEN	Benzamidine	C7 H8 N2	1

Water and common crystallization additives (CL, SO4) are not listed.

Primary citation

Solitary and Repetitive Binding Motifs for the Ap2 Complex {Alpha}-Appendage in Amphiphysin and Other Accessory Proteins. Olesen, L.E., Ford, M.G.J., Schmid, E.M. et al. J Biol Chem (2008) 283:5099. DOI 10.1074/JBC.M708621200 · PubMed

Other PDB entries of the same protein (UniProt P17427 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KYF 1.22 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1QTS 1.4 Å, Crystal structure of the ap-2 clathrin adaptor alpha-appendage
7OHI 1.41 Å, FCHO1-peptide-AP2 alpha ear complex
1QTP 1.6 Å, Crystal structure of the ap-2 clathrin adaptor alpha-appendage
1KYU 1.8 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1B9K 1.9 Å, Alpha-adaptin appendage domain, from clathrin adaptor AP2
1W80 1.9 Å, Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex,…
3HS8 1.9 Å, Intersectin 1-peptide-AP2 alpha ear complex
9PUE 1.91 Å, Structure of Alpha Appendage of AP2 bound to the FxDxF motif derived of CCDC32
1KY6 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
1KYD 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
9PPP 2.1 Å, Structure of Alpha Appendage of AP2 bound to the extended FxDxF motif derived of CCDC32

Browse structure collections

About this viewer

MolViewer shows 2VJ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.