Nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinB2. Determined by X-ray diffraction at 1.8 Å resolution. Released 20 May 2008.
Explore 2VSM in 3D Show helices and sheets RCSB PDB PDBe
2VSM contains 14 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 201-203 | 3 | 1 |
| β-strand | 215-225 | 11 | 2 |
| β-strand | 228-237 | 10 | 2 |
| β-strand | 244-257 | 14 | 2 |
| β-strand | 263-271 | 9 | 2 |
| β-strand | 279-287 | 9 | 3 |
| β-strand | 290-297 | 8 | 3 |
| β-strand | 314-320 | 7 | 3 |
| α-helix | 328-331 | 4 | |
| β-strand | 332-336 | 5 | 3 |
| β-strand | 340-341 | 2 | 4 |
| β-strand | 347-350 | 4 | 4 |
| β-strand | 354 | 1 | 3 |
| β-strand | 356-358 | 3 | 4 |
| β-strand | 361-371 | 11 | 4 |
| α-helix | 372-374 | 3 | |
| α-helix | 379-381 | 3 | |
| α-helix | 394-397 | 4 | |
| β-strand | 407-417 | 11 | 4 |
| α-helix | 418-420 | 3 | |
| β-strand | 426-430 | 5 | 4 |
| β-strand | 431 | 1 | 5 |
| α-helix | 432 | 1 | |
| β-strand | 442-447 | 6 | 6 |
| β-strand | 450-455 | 6 | 6 |
| β-strand | 465-471 | 7 | 6 |
| β-strand | 475 | 1 | 5 |
| β-strand | 476-479 | 4 | 6 |
| β-strand | 509 | 1 | 1 |
| β-strand | 511-515 | 5 | 7 |
| β-strand | 520-526 | 7 | 7 |
| β-strand | 533 | 1 | 1 |
| β-strand | 535-541 | 7 | 7 |
| β-strand | 544-550 | 7 | 7 |
| β-strand | 557-568 | 12 | 1 |
| β-strand | 571-581 | 11 | 1 |
| β-strand | 587-588 | 2 | 2 |
| β-strand | 591-596 | 6 | 1 |
| α-helix | 597-598 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 32 | 1 | 8 |
| α-helix | 33-35 | 3 | |
| β-strand | 36-37 | 2 | 8 |
| β-strand | 46 | 1 | 9 |
| β-strand | 50 | 1 | 9 |
| β-strand | 51-53 | 3 | 10 |
| α-helix | 55-56 | 2 | |
| β-strand | 60-65 | 6 | 8 |
| α-helix | 66-68 | 3 | |
| α-helix | 75-77 | 3 | |
| β-strand | 78 | 1 | 11 |
| β-strand | 79-81 | 3 | 12 |
| β-strand | 82-84 | 3 | 10 |
| α-helix | 86-91 | 6 | |
| β-strand | 93 | 1 | 13 |
| β-strand | 102-104 | 3 | 12 |
| β-strand | 111-116 | 6 | 8 |
| β-strand | 133-138 | 6 | 10 |
| β-strand | 143 | 1 | 11 |
| α-helix | 145-147 | 3 | |
| β-strand | 152 | 1 | 13 |
| α-helix | 154-158 | 5 | |
| β-strand | 162-167 | 6 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hemagglutinin-neuraminidase | A | protein | 416 | Nipah virus | Q9IH62 (AlphaFold model) |
| Ephrin-B2 | B | protein | 140 | Homo sapiens | P52799 (AlphaFold model) |
>2VSM_1 HEMAGGLUTININ-NEURAMINIDASE (chains A) ICLQKTSNQILKPKLISYTLPVVGQSGTCITDPLLAMDEGYFAYSHLERIGSCSRGVSKQ RIIGVGEVLDRGDEVPSLFMTNVWTPPNPNTVYHCSAVYNNEFYYVLCAVSTVGDPILNS TYWSGSLMMTRLAVKPKSNGGGYNQHQLALRSIEKGRYDKVMPYGPSGIKQGDTLYFPAV GFLVRTEFKYNDSNCPITKCQYSKPENCRLSMGIRPNSHYILRSGLLKYNLSDGENPKVV FIEISDQRLSIGSPSKIYDSLGQPVFYQASFSWDTMIKFGDVLTVNPLVVNWRNNTVISR PGQSQCPRFNTCPEICWEGVYNDAFLIDRINWISAGVFLDSNQTAENPVFTVFKDNEILY RAQLASEDTNAQKTITNCFLLKNKIWCISLVEIYDTGDNVIRPKLFAVKIPEQCTH
>2VSM_2 EPHRIN-B2 (chains B) IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQAD RCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDN QEGGVCQTRAMKILMKVGHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 4 |
| IPA | Isopropyl alcohol | C3 H8 O | 1 |
Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2. Bowden, T.A., Aricescu, A.R., Gilbert, R.J. et al. Nat Struct Mol Biol (2008) 15:567. DOI 10.1038/NSMB.1435 · PubMed
Other PDB entries of the same protein (UniProt Q9IH62 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2VSM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.