Crystal Structure of the Botulinum Neurotoxin Serotype A binding domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 26 Aug 2008.
Explore 2VUA in 3D Show helices and sheets RCSB PDB PDBe
2VUA contains 11 α-helices and 43 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 877-880 | 4 | 1 |
| β-strand | 881-884 | 4 | 2 |
| β-strand | 887-890 | 4 | 2 |
| β-strand | 897-900 | 4 | 3 |
| β-strand | 904-906 | 3 | 1 |
| β-strand | 914-917 | 4 | 1 |
| β-strand | 924-927 | 4 | 3 |
| α-helix | 930-932 | 3 | |
| β-strand | 935-936 | 2 | 4 |
| β-strand | 941-948 | 8 | 1 |
| α-helix | 950-952 | 3 | |
| α-helix | 955-957 | 3 | |
| β-strand | 962-969 | 8 | 3 |
| β-strand | 972-979 | 8 | 3 |
| β-strand | 982-988 | 7 | 3 |
| β-strand | 994-1000 | 7 | 3 |
| β-strand | 1004 | 1 | 5 |
| β-strand | 1015-1021 | 7 | 1 |
| β-strand | 1026-1031 | 6 | 1 |
| β-strand | 1034-1040 | 7 | 1 |
| β-strand | 1047-1048 | 2 | 4 |
| β-strand | 1052-1058 | 7 | 3 |
| β-strand | 1066-1075 | 10 | 1 |
| α-helix | 1081-1092 | 12 | |
| β-strand | 1096 | 1 | 6 |
| β-strand | 1098 | 1 | 7 |
| β-strand | 1104 | 1 | 7 |
| α-helix | 1105 | 1 | |
| β-strand | 1106 | 1 | 8 |
| β-strand | 1111-1115 | 5 | 9 |
| β-strand | 1122-1126 | 5 | 9 |
| β-strand | 1133-1137 | 5 | 9 |
| β-strand | 1142-1145 | 4 | 5 |
| β-strand | 1149-1152 | 4 | 5 |
| β-strand | 1160-1164 | 5 | 9 |
| β-strand | 1173 | 1 | 8 |
| α-helix | 1174 | 1 | |
| β-strand | 1175 | 1 | 6 |
| β-strand | 1179-1185 | 7 | 9 |
| β-strand | 1190-1194 | 5 | 9 |
| β-strand | 1195 | 1 | 10 |
| β-strand | 1204-1205 | 2 | 9 |
| β-strand | 1207-1209 | 3 | 9 |
| α-helix | 1211-1213 | 3 | |
| β-strand | 1218 | 1 | 10 |
| β-strand | 1220-1225 | 6 | 9 |
| β-strand | 1235-1240 | 6 | 9 |
| β-strand | 1246-1255 | 10 | 9 |
| β-strand | 1258-1264 | 7 | 9 |
| α-helix | 1265-1268 | 4 | |
| α-helix | 1271 | 1 | |
| α-helix | 1275-1277 | 3 | |
| β-strand | 1282-1285 | 4 | 9 |
| α-helix | 1293-1295 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Botulinum neurotoxin a heavy chain | A | protein | 444 | CLOSTRIDIUM BOTULINUM | P0DPI1 (AlphaFold model) |
>2VUA_1 BOTULINUM NEUROTOXIN A HEAVY CHAIN (chains A) MGSSHHHHHHSSGLVPRGSHMDTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQ IQLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNSG WKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIYING RLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLYDNQSN SGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYLNSS LYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPD VGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVASNWYNRQIER SSRTLGCSWEFIPVDDGWGERPLQ
Crystal Structure of Botulinum Neurotoxin Type a in Complex with the Cell Surface Co-Receptor Gt1B- Insight Into the Toxin-Neuron Interaction. Stenmark, P., Dupuy, J., Imamura, A. et al. PLoS Pathog (2008) 4:E129. DOI 10.1371/JOURNAL.PPAT.1000129 · PubMed
Other PDB entries of the same protein (UniProt P0DPI1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2VUA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.