2VV5: The open structure of MscS

The open structure of MscS. Determined by X-ray diffraction at 3.45 Å resolution. Released 5 Aug 2008.

Method: X-ray diffraction
Resolution: 3.45 Å
Organism: ESCHERICHIA COLI
Chains: 7
Atoms: 13,692
Mol. weight: 216.66 kDa
Released: 5 Aug 2008

Explore 2VV5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VV5 contains 63 α-helices and 70 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and G: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	26-28	3
α-helix	30-59	30
α-helix	63-87	25
α-helix	96-111	16
α-helix	113-125	13
β-strand	135-137	3	1
β-strand	142-148	7	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-171	5
β-strand	175-177	3	1
β-strand	183-192	10	2
α-helix	198-211	14
β-strand	215	1	2
β-strand	221-228	8	2
β-strand	233-242	10	2
α-helix	246-264	19
α-helix	269-271	3
β-strand	272-278	7	3

Chain E: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	26-28	3
α-helix	30-59	30
α-helix	63-87	25
α-helix	96-111	16
α-helix	113-125	13
β-strand	135-137	3	1
β-strand	142-148	7	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-171	5
β-strand	175-177	3	1
β-strand	183-192	10	7
α-helix	198-211	14
β-strand	215	1	7
β-strand	221-228	8	7
β-strand	233-242	10	7
α-helix	246-263	18
α-helix	269-271	3
β-strand	272-279	8	3

Chain F: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	26-28	3
α-helix	30-59	30
α-helix	63-87	25
α-helix	96-111	16
α-helix	113-125	13
β-strand	135-137	3	1
β-strand	142-148	7	1
β-strand	152-156	5	1
β-strand	162-166	5	1
α-helix	167-171	5
β-strand	175-177	3	1
β-strand	183-192	10	8
α-helix	198-211	14
β-strand	215	1	8
β-strand	221-228	8	8
β-strand	233-242	10	8
α-helix	246-264	19
α-helix	269-271	3
β-strand	272-279	8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small-conductance mechanosensitive channel	A, B, C, D, E, F, G	protein	286	ESCHERICHIA COLI	P0C0S1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>2VV5_1 SMALL-CONDUCTANCE MECHANOSENSITIVE CHANNEL (chains A, B, C, D, E, F, G)
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLVVGLALQGSLSNLAA
GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR
EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW
SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA

Primary citation

The Structure of an Open Form of an E. Coli Mechanosensitive Channel at 3.45 A Resolution. Wang, W., Black, S.S., Edwards, M.D. et al. Science (2008) 321:1179. DOI 10.1126/SCIENCE.1159262 · PubMed

Other PDB entries of the same protein (UniProt P0C0S1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ONJ 2.3 Å, Mechanosensitive channel MscS solubilized with LMNG in open conformation
9E68 2.5 Å, Cryo-EM structure of MscS/YnaI chimera in DOPC nanodiscs
7OOA 2.7 Å, Mechanosensitive channel MscS solubilized with LMNG in open conformation with added lipid
9H2S 2.7 Å, a YnaI-MscS chimera in a closed conformation purified in DDM with additional lipids…
9H2V 2.8 Å, a YnaI-MscS chimera in an open conformation purified in DDM showing ligand-filled pockets
6RLD 2.9 Å, Structure of the mechanosensitive channel mscs embedded in the membrane bilayer
5AJI 2.99 Å, MscS D67R1 high resolution
6PWN 3.1 Å, MscS Nanodisc with N-terminal His-Tag
7OO0 3.1 Å, Mechanosensitive channel MscS solubilized with DDM in open conformation
7OO6 3.1 Å, Mechanosensitive channel MscS solubilized with DDM in closed conformation with added lipid
8DDJ 3.1 Å, Open MscS in PC14.1 Nanodiscs
6VYK 3.2 Å, Cryo-EM structure of mechanosensitive channel MscS in PC-18:1 nanodiscs

Browse structure collections

About this viewer

MolViewer shows 2VV5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.