2VX8: Vamp7 longin domain Hrb peptide complex

Vamp7 longin domain Hrb peptide complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 16 Sept 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: HOMO SAPIENS, MUS MUSCULUS
Chains: 4
Atoms: 4,418
Mol. weight: 74.83 kDa
Released: 16 Sept 2008

Explore 2VX8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VX8 contains 26 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	24-26	3	1
α-helix	27-31	5
β-strand	48-53	6	2
β-strand	56-62	7	2
β-strand	66	1	3
α-helix	68-76	9
β-strand	84-90	7	2
β-strand	93-100	8	2
β-strand	103-110	8	2
α-helix	115-133	19
α-helix	136-138	3
α-helix	140-141	2
α-helix	146-153	8

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
β-strand	24-26	3	2
α-helix	28-31	4
α-helix	32-34	3
β-strand	40	1	3
α-helix	41-43	3
β-strand	46-53	8	1
β-strand	56-62	7	1
α-helix	68-78	11
β-strand	84-90	7	1
β-strand	93-100	8	1
β-strand	103-110	8	1
α-helix	118-133	16
α-helix	134-138	5
α-helix	146-156	11

Chain C: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	24-26	3	4
α-helix	28-31	4
α-helix	32-34	3
β-strand	40	1	5
β-strand	48-53	6	4
β-strand	56-62	7	4
β-strand	66	1	5
α-helix	68-76	9
β-strand	84-90	7	4
β-strand	93-100	8	4
β-strand	103-110	8	4
α-helix	115-132	18
α-helix	134-138	5
α-helix	147-152	6

Chain D: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	24-26	3	6
α-helix	28-31	4
α-helix	35-38	4
β-strand	46-53	8	6
β-strand	56-62	7	6
α-helix	68-78	11
β-strand	84-90	7	6
β-strand	93-100	8	6
β-strand	103-110	8	6
α-helix	118-133	16
α-helix	136-139	4
α-helix	146-155	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin-like protein rip, vesicle-associated membrane protein 7	A, B, C, D	protein	169	HOMO SAPIENS, MUS MUSCULUS	P52594 (AlphaFold model), P70280 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2VX8_1 NUCLEOPORIN-LIKE PROTEIN RIP, VESICLE-ASSOCIATED MEMBRANE PROTEIN 7 (chains A, B, C, D)
GSVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGMAILFAVVARGTTILAK
HAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFS
FLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENHHHHHH

Primary citation

Molecular Basis for the Sorting of the Snare Vamp7 Into Endocytic Clathrin-Coated Vesicles by the Arfgap Hrb. Pryor, P.R., Jackson, L., Gray, S.R. et al. Cell (2008) 134:817. DOI 10.1016/J.CELL.2008.07.023 · PubMed

Other PDB entries of the same protein (UniProt P52594 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OLM 1.48 Å, ArfGap domain of HIV-1 Rev binding protein
2D9L Solution structure of the ArfGap domain of human RIP

Browse structure collections

About this viewer

MolViewer shows 2VX8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.