2VZC: Alpha-parvin

Crystal structure of the C-terminal calponin homology domain of alpha parvin. Determined by X-ray diffraction at 1.05 Å resolution. Released 28 Oct 2008.

Method: X-ray diffraction
Resolution: 1.05 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,095
Mol. weight: 30.76 kDa
Ligands: MRD
Released: 28 Oct 2008

Explore 2VZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2VZC contains 19 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	249-256	8
α-helix	258-276	19
α-helix	277-279	3
α-helix	294-303	10
α-helix	307-309	3
α-helix	310-312	3
α-helix	320-336	17
α-helix	339-342	4
α-helix	346-350	5
α-helix	354-368	15

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	249-256	8
α-helix	258-276	19
α-helix	277-279	3
α-helix	294-304	11
α-helix	310-312	3
α-helix	320-336	17
α-helix	339-342	4
α-helix	346-350	5
α-helix	354-368	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-parvin	A, B	protein	131	HOMO SAPIENS	Q9NVD7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2VZC_1 ALPHA-PARVIN (chains A, B)
SGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMG
LLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVL
YNLFTKYRNVE

Ligands and cofactors

ID	Name	Formula	Copies
MRD	(4R)-2-methylpentane-2,4-diol	C6 H14 O2	1

Water and common crystallization additives (MPD, GOL, TRS) are not listed.

Primary citation

Structural Analysis of the Interactions between Paxillin Ld Motifs and Alpha-Parvin. Lorenz, S., Vakonakis, I., Lowe, E.D. et al. Structure (2008) 16:1521. DOI 10.1016/J.STR.2008.08.007 · PubMed

Other PDB entries of the same protein (UniProt Q9NVD7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TP9 1.45 Å, Crystal structure of integrin-linked kinase (ILK) in complex with Alpha-Parvin and…
9D5E 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to gefitinib
9D5F 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to bosutinib
9D5H 1.5 Å, Crystal structure of the ILK mutant (R371Q)/alpha-parvin core complex bound to gefitinib
9D5I 1.5 Å, Crystal structure of the ILK mutant (R225A)/alpha-parvin core complex bound to MgATP
9D5P 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to erlotinib
9TPD 1.5 Å, Crystal structure of integrin-linked kinase (ILK) in complex with alpha-parvin and a…
9D5G 1.55 Å, Crystal structure of the ILK/alpha-parvin core complex bound to 4-methyl erlotinib
2VZG 1.8 Å, Crystal structure of the C-terminal calponin homology domain of alpha- parvin in complex…
3KMU 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (apo)
3REP 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (MnATP)
6MIB 1.8 Å, Crystal structure of the ILK ATP-binding deficient mutant (L207W)/alpha-parvin core…

Browse structure collections

About this viewer

MolViewer shows 2VZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.