2W4J: DAP-Kinase 2-277

X-ray structure of a DAP-Kinase 2-277. Determined by X-ray diffraction at 1.3 Å resolution. Released 22 Dec 2009.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,675
Mol. weight: 32.36 kDa
Ligands: MG, ADP
Released: 22 Dec 2009

Explore 2W4J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W4J contains 15 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
α-helix	9-11	3
β-strand	13-22	10	1
β-strand	25-32	8	1
β-strand	38-45	8	1
β-strand	46	1	2
α-helix	47	1
β-strand	56	1	2
α-helix	58-70	13
β-strand	76	1	3
β-strand	79-84	6	1
β-strand	88-94	7	1
α-helix	95	1
β-strand	100	1	3
α-helix	101-107	7
α-helix	113-132	20
β-strand	135-136	2	4
α-helix	142-144	3
β-strand	145-147	3	3
β-strand	157-159	3	3
β-strand	166-167	2	4
β-strand	173	1	5
α-helix	186-189	4
β-strand	194	1	5
α-helix	197-212	16
α-helix	222-230	9
α-helix	238-241	4
α-helix	246-255	10
α-helix	260-262	3
α-helix	264-265	2
α-helix	266-271	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Death-associated protein kinase 1	A	protein	277	HOMO SAPIENS	P53355 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2W4J_1 DEATH-ASSOCIATED PROTEIN KINASE 1 (chains A)
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKP

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

X-Ray Structure of a Dap-Kinase Calmodulin Complex. De Diego, I., Kuper, J., Lehmann, F. et al. To be published.

Other PDB entries of the same protein (UniProt P53355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GY5 1.09 Å, Crystal structure of the kelch domain of human KLHL20 in complex with DAPK1 peptide
4PF4 1.13 Å, 1.1A X-ray structure of the apo catalytic domain of death-associated protein kinase 1,…
3GU4 1.35 Å, Crystal structure of DAPKQ23V-AMPPNP
9N2M 1.35 Å, Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-30-047SRM
4YPD 1.4 Å, Crystal Structure of DAPK1 catalytic domain in complex with the hinge binding fragment…
5AV4 1.4 Å, Crystal structure of DAPK1-genistein complex in the presence of bromide ions.
7CCW 1.4 Å, Crystal structure of death-associated protein kinase 1 in complex with resveratrol and MES
9N1T 1.43 Å, Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound SRM-26-100
3GU6 1.49 Å, Crystal structure of DAPKQ23V-ADP
9N2O 1.49 Å, Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-27-040SRM
9O73 1.49 Å, Crystal Structure of Human DAPK1 Catalytic Subunit Complexed with Compound MW01-30-035SRM
1JKS 1.5 Å, 1.5A X-ray structure of apo form of a catalytic domain of death-associated protein kinase

Browse structure collections

About this viewer

MolViewer shows 2W4J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.