2W60: Anti citrullinated Collagen type 2 antibody acc4

Anti citrullinated Collagen type 2 antibody acc4. Determined by X-ray diffraction at 1.5 Å resolution. Released 24 Feb 2009.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: MUS MUSCULUS
Chains: 2
Atoms: 3,917
Mol. weight: 47.41 kDa
Released: 24 Feb 2009

Explore 2W60 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W60 contains 17 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	46-51	6	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	68-73	6	1
α-helix	74-76	3
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-98	7	2
β-strand	107-108	2	2
β-strand	112-116	5	2
β-strand	122	1	3
α-helix	123-124	2
β-strand	125-129	5	4
β-strand	140-150	11	4
β-strand	151	1	3
β-strand	156-159	4	5
α-helix	160-162	3
β-strand	164	1	5
β-strand	168-170	3	4
α-helix	171-173	3
β-strand	174-175	2	4
β-strand	180-189	10	4
β-strand	199-204	6	5
α-helix	205-207	3
β-strand	209-214	6	5

Chain B: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	30	1	8
β-strand	36	1	8
β-strand	38-43	6	7
β-strand	50-54	5	7
β-strand	58-59	2	7
α-helix	60	1
β-strand	67-72	6	6
β-strand	75-80	6	6
α-helix	85-87	3
β-strand	89-95	7	7
α-helix	101	1
β-strand	102-103	2	7
β-strand	107-111	5	7
β-strand	116	1	9
α-helix	117-118	2
β-strand	119-123	5	10
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	10
β-strand	145	1	9
β-strand	150-155	6	11
β-strand	158-159	2	11
β-strand	163-168	6	10
α-helix	169-172	4
β-strand	178-187	10	10
α-helix	188-191	4
β-strand	196-202	7	11
α-helix	209	1
β-strand	210-215	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Anti-citrullinated collagen type II FAB ACC4	A	protein	218	MUS MUSCULUS
Anti-citrullinated collagen type II FAB ACC4	B	protein	217	MUS MUSCULUS	P01837 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2W60_1 ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4 (chains A)
QIQLVQSGPELKKPGETVKISCKASGYTFTDYSIHWVKQAPGKGLKWMGWINTETGEPTY
TDDFKGRFAFSLESSASTAFLQINNLKNEDTATYFCARATTATELAYWGQGTLVTVSAAK
TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY
TLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR

Sequence of entity 2 (B), FASTA

>2W60_2 ANTI-CITRULLINATED COLLAGEN TYPE II FAB ACC4 (chains B)
DVVMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLD
SGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPLTFGAGTKLELKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Primary citation

Structure and pathogenicity of antibodies specific for citrullinated collagen type II in experimental arthritis. Uysal, H., Bockermann, R., Nandakumar, K.S. et al. J Exp Med (2009) 206:449-462. DOI 10.1084/jem.20081862 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…
2R23 1.65 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues

Browse structure collections

About this viewer

MolViewer shows 2W60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.