2W6J: PDB entry 2W6J

Low resolution structures of bovine mitochondrial F1-ATPase during controlled dehydration: Hydration State 5. Determined by X-ray diffraction at 3.84 Å resolution. Released 27 Oct 2009.

Method: X-ray diffraction
Resolution: 3.84 Å
Organism: BOS TAURUS
Chains: 9
Atoms: 23,874
Mol. weight: 404.95 kDa
Released: 27 Oct 2009

Explore 2W6J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2W6J contains 165 α-helices and 170 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	28-35	8	1
β-strand	38-43	6	1
α-helix	47-48	2
β-strand	52-55	4	1
β-strand	60-66	7	1
β-strand	71-75	5	1
α-helix	79-81	3
β-strand	87-90	4	1
β-strand	96-99	4	2
α-helix	101-103	3
β-strand	107-108	2	3
β-strand	114	1	3
β-strand	125-128	4	2
α-helix	132-134	3
β-strand	139	1	4
β-strand	145	1	5
α-helix	151-156	6
β-strand	160	1	5
β-strand	164	1	3
β-strand	166-169	4	6
α-helix	175-185	11
α-helix	187-190	4
β-strand	200-206	7	3
α-helix	210-222	13
α-helix	226-228	3
β-strand	229-234	6	3
α-helix	240-258	19
β-strand	263-269	7	3
α-helix	271-284	14
α-helix	287-289	3
α-helix	291-293	3
α-helix	298-306	9
β-strand	310-311	2	3
β-strand	312	1	4
α-helix	313	1
α-helix	314-316	3
β-strand	320-325	6	3
β-strand	326-328	3	6
α-helix	337-345	9
β-strand	348-351	4	6
β-strand	352	1	7
α-helix	354-359	6
β-strand	365	1	7
β-strand	371-372	2	6
α-helix	375-378	4
α-helix	381-400	20
α-helix	401-403	3
α-helix	412-426	15
α-helix	435-437	3
α-helix	438-449	12
α-helix	458-460	3
α-helix	461-475	15
α-helix	477-485	9
α-helix	491-508	18

Chain B: 25 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	28-34	7	1
β-strand	38-43	6	1
α-helix	47	1
β-strand	48	1	8
β-strand	51-55	5	1
β-strand	60-66	7	1
β-strand	71-75	5	1
α-helix	79-81	3
β-strand	87-94	8	1
β-strand	96-98	3	9
α-helix	101-103	3
β-strand	107-108	2	10
β-strand	114	1	10
β-strand	126-128	3	9
α-helix	131-134	4
β-strand	139	1	11
β-strand	145	1	12
α-helix	151-156	6
β-strand	160	1	12
β-strand	164	1	10
β-strand	166-169	4	13
α-helix	175-185	11
α-helix	187-190	4
β-strand	200-206	7	10
α-helix	210-222	13
α-helix	226-228	3
β-strand	229-234	6	10
α-helix	240-259	20
β-strand	263-269	7	10
α-helix	271-284	14
α-helix	287-288	2
β-strand	289	1	14
α-helix	291-293	3
β-strand	295	1	14
α-helix	298-306	9
β-strand	311	1	10
β-strand	312	1	11
α-helix	314-316	3
β-strand	320-325	6	10
β-strand	326-328	3	13
α-helix	337-343	7
β-strand	348-352	5	13
α-helix	354-359	6
β-strand	365	1	13
β-strand	371-372	2	13
α-helix	376-378	3
α-helix	381-395	15
α-helix	412-427	16
α-helix	438-450	13
α-helix	458-460	3
α-helix	461-474	14
α-helix	477-486	10
α-helix	491-507	17

Chain C: 28 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	28-35	8	1
β-strand	38-43	6	1
α-helix	47	1
β-strand	48	1	15
β-strand	52-55	4	1
β-strand	60-66	7	1
β-strand	71-75	5	1
α-helix	79-81	3
β-strand	87-90	4	1
β-strand	96-99	4	16
α-helix	101-103	3
β-strand	107-108	2	17
β-strand	114	1	17
β-strand	125-128	4	16
α-helix	131-134	4
β-strand	139	1	18
β-strand	145	1	19
α-helix	151-156	6
β-strand	160	1	19
β-strand	164	1	17
β-strand	166-169	4	20
α-helix	175-185	11
α-helix	187-190	4
β-strand	200-206	7	17
α-helix	210-222	13
α-helix	226-228	3
β-strand	229-234	6	17
α-helix	240-258	19
β-strand	263-269	7	17
α-helix	271-284	14
α-helix	287-288	2
β-strand	289	1	21
α-helix	291-293	3
β-strand	295	1	21
α-helix	298-306	9
β-strand	311	1	17
β-strand	312	1	18
α-helix	313	1
α-helix	314-316	3
β-strand	320-325	6	17
β-strand	326-328	3	20
α-helix	337-343	7
β-strand	348-352	5	20
α-helix	354-359	6
β-strand	365	1	20
β-strand	371-372	2	20
α-helix	375-378	4
α-helix	381-387	7
α-helix	390-403	14
α-helix	412-427	16
α-helix	435-437	3
α-helix	438-449	12
α-helix	458-460	3
α-helix	461-475	15
α-helix	477-486	10
α-helix	491-509	19

Chain D: 28 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
β-strand	20-25	6	1
α-helix	29-31	3
β-strand	35-38	4	1
β-strand	46-54	9	1
β-strand	57-62	6	1
β-strand	70	1	15
β-strand	74-77	4	1
β-strand	83-85	3	22
α-helix	88-90	3
β-strand	91	1	23
β-strand	94-95	2	23
β-strand	101	1	23
β-strand	113-115	3	22
α-helix	119-122	4
α-helix	123-125	3
β-strand	132-133	2	24
α-helix	138-143	6
β-strand	146-147	2	24
β-strand	151-156	6	23
α-helix	162-169	8
α-helix	170-174	5
β-strand	180-186	7	23
α-helix	190-203	14
β-strand	215-220	6	23
α-helix	226-242	17
α-helix	243-247	5
β-strand	251-256	6	23
α-helix	259-269	11
α-helix	270-272	3
α-helix	274-276	3
α-helix	278-280	3
α-helix	285-293	9
β-strand	304-311	8	23
α-helix	313-315	3
α-helix	320-325	6
α-helix	326-328	3
β-strand	331-334	4	23
β-strand	335	1	25
α-helix	337-340	4
β-strand	348	1	25
β-strand	354-355	2	23
α-helix	360-363	4
α-helix	365-391	27
α-helix	393-395	3
α-helix	398-413	16
α-helix	419-421	3
α-helix	422-425	4
α-helix	434-445	12
α-helix	454-457	4
α-helix	463-474	12

Chain E: 21 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
β-strand	20-24	5	1
α-helix	29-31	3
β-strand	34-38	5	1
β-strand	46-54	9	1
β-strand	57-62	6	1
β-strand	74-81	8	1
β-strand	83-86	4	26
α-helix	88-90	3
β-strand	94-95	2	27
β-strand	101	1	27
β-strand	112-115	4	26
α-helix	119-122	4
α-helix	123-125	3
β-strand	126	1	28
β-strand	132-133	2	29
α-helix	138-143	6
β-strand	146-147	2	29
β-strand	151-155	5	27
α-helix	162-176	15
β-strand	181-188	8	27
α-helix	190-203	14
β-strand	215-221	7	27
α-helix	226-245	20
β-strand	250-256	7	27
α-helix	258-271	14
α-helix	274-276	3
α-helix	278-280	3
α-helix	285-293	9
β-strand	298	1	27
β-strand	299	1	28
β-strand	303-309	7	27
α-helix	313-315	3
α-helix	320-326	7
β-strand	331-334	4	27
β-strand	335	1	30
α-helix	337-341	5
β-strand	348	1	30
β-strand	355	1	27
α-helix	365-383	19
α-helix	398-413	16
α-helix	428-429	2
α-helix	434-445	12
α-helix	455-457	3
α-helix	463-472	10

Chain F: 26 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
β-strand	20-25	6	1
α-helix	30-31	2
β-strand	35-38	4	1
β-strand	46-54	9	1
β-strand	57-62	6	1
β-strand	70	1	8
β-strand	74-77	4	1
β-strand	83-86	4	31
α-helix	88-90	3
β-strand	94-95	2	32
β-strand	101	1	32
β-strand	112-115	4	31
α-helix	119-122	4
α-helix	123-125	3
β-strand	132-133	2	33
α-helix	138-143	6
β-strand	146-147	2	33
β-strand	151-156	6	32
α-helix	162-172	11
β-strand	180-186	7	32
α-helix	190-203	14
β-strand	215-220	6	32
α-helix	226-245	20
β-strand	251-256	6	32
α-helix	259-272	14
α-helix	274-276	3
α-helix	278-280	3
α-helix	285-293	9
β-strand	299	1	34
β-strand	302	1	34
β-strand	304-311	8	32
α-helix	313-315	3
α-helix	320-325	6
α-helix	326-328	3
β-strand	331-334	4	32
β-strand	335	1	35
α-helix	337-341	5
β-strand	348	1	35
β-strand	354-355	2	32
α-helix	360-363	4
α-helix	365-382	18
α-helix	385-391	7
α-helix	393-395	3
α-helix	398-413	16
α-helix	419-421	3
α-helix	422-425	4
α-helix	434-445	12
α-helix	454-457	4
α-helix	463-473	11

Chain G: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	3-45	43
β-strand	71	1	36
α-helix	82-85	4
β-strand	108	1	36
α-helix	110-115	6
β-strand	128	1	36
α-helix	135-136	2
α-helix	138-147	10
β-strand	164-165	2	37
β-strand	171-172	2	37
α-helix	207-269	63

Chain H: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	20-21	2	38
β-strand	26-28	3	38
β-strand	37	1	39
β-strand	61	1	40
β-strand	64	1	39
β-strand	77	1	40
β-strand	80	1	41
β-strand	92-93	2	38
β-strand	94	1	41
β-strand	97	1	40
α-helix	108-119	12
α-helix	129-139	11

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATP synthase subunit alpha heart isoform, mitochondrial	A, B, C	protein	553	BOS TAURUS	P19483 (AlphaFold model)
ATP synthase subunit beta, mitochondrial	D, E, F	protein	528	BOS TAURUS	P00829 (AlphaFold model)
ATP synthase subunit gamma, mitochondrial	G	protein	298	BOS TAURUS	P05631 (AlphaFold model)
F1-atpase delta subunit	H	protein	168	BOS TAURUS	P05630 (AlphaFold model)
ATP synthase subunit epsilon, mitochondrial	I	protein	51	BOS TAURUS	P05632

Sequence of entity 1 (A, B, C), FASTA

>2W6J_1 ATP SYNTHASE SUBUNIT ALPHA HEART ISOFORM, MITOCHONDRIAL (chains A, B, C)
MLSVRVAAAVARALPRRAGLVSKNALGSSFIAARNLHASNSRLQKTGTAEVSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKARRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALLSKIRTDGKISEESDAKL
KEIVTNFLAGFEA

Sequence of entity 2 (D, E, F), FASTA

>2W6J_2 ATP SYNTHASE SUBUNIT BETA, MITOCHONDRIAL (chains D, E, F)
MLGLVGRVVAASASGALRGLSPSAPLPQAQLLLRAAPAALQPARDYAAQASPSPKAGATT
GRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLV
RGQKVLDSGAPIRIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFVEMSVEQ
EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT
REGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD
VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAI
YVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHLGK
LVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHS

Sequence of entity 3 (G), FASTA

>2W6J_3 ATP SYNTHASE SUBUNIT GAMMA, MITOCHONDRIAL (chains G)
MFSRAGVAGLSAWTVQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARVYGVGSLALYEKADIKTPEDKKKHLIIGVSSDRGLCGAIHSSVAKQMKSEAAN
LAAAGKEVKIIGVGDKIRSILHRTHSDQFLVTFKEVGRRPPTFGDASVIALELLNSGYEF
DEGSIIFNRFRSVISYKTEEKPIFSLDTISSAESMSIYDDIDADVLRNYQEYSLANIIYY
SLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD

Sequence of entity 4 (H), FASTA

>2W6J_4 F1-ATPASE DELTA SUBUNIT (chains H)
MLPSALLRRPGLGRLVRQVRLYAEAAAAQAPAAGPGQMSFTFASPTQVFFNSANVRQVDV
PTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAV
TLDMLDLGAAKANLEKAQSELLGAADEATRAEIQIRIEANEALVKALE

Sequence of entity 5 (I), FASTA

>2W6J_5 ATP SYNTHASE SUBUNIT EPSILON, MITOCHONDRIAL (chains I)
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAMKTSGSTIKIVKVKKE

Primary citation

Improving diffraction by humidity control: a novel device compatible with X-ray beamlines. Sanchez-Weatherby, J., Bowler, M.W., Huet, J. et al. Acta Crystallogr D Biol Crystallogr (2009) 65:1237-1246. DOI 10.1107/S0907444909037822 · PubMed

Other PDB entries of the same protein (UniProt P19483 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2JDI 1.9 Å, Ground state structure of F1-ATPase from bovine heart mitochondria (Bovine F1-ATPase…
2CK3 1.95 Å, Azide inhibited bovine F1-ATPase
1H8E 2.0 Å, (ADP.AlF4)2(ADP.SO4) bovine F1-ATPase (all three catalytic sites occupied)
2V7Q 2.1 Å, The structure of F1-ATPase inhibited by I1-60HIS, a monomeric form of the inhibitor…
1W0J 2.2 Å, Beryllium fluoride inhibited bovine F1-ATPase
2JIZ 2.3 Å, The Structure of F1-ATPase inhibited by resveratrol.
9VPD 2.3 Å, Cryo-EM structure of the IF1 bound bovine ATP synthase monomer: rotary state 1, F1…
1E79 2.4 Å, Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)
2JJ2 2.4 Å, The Structure of F1-ATPase inhibited by quercetin.
1E1R 2.5 Å, Bovine mitochondrial F1-atpase inhibited by MG2+ADP and aluminium fluoride
4ASU 2.6 Å, F1-ATPase in which all three catalytic sites contain bound nucleotide, with magnesium…
1E1Q 2.61 Å, Bovine mitochondrial F1-atpase at 100K

Browse structure collections

About this viewer

MolViewer shows 2W6J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.