2WP1: Brdt bromodomain 2

Structure of Brdt bromodomain 2 bound to an acetylated histone H3 peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 22 Sept 2009.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: MUS MUSCULUS
Chains: 4
Atoms: 2,247
Mol. weight: 31.88 kDa
Released: 22 Sept 2009

Explore 2WP1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WP1 contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	264-282	19
α-helix	285-287	3
α-helix	288-291	4
α-helix	292-294	3
α-helix	300-303	4
α-helix	308-311	4
α-helix	318-326	9
α-helix	333-350	18
α-helix	356-372	17

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	266-282	17
α-helix	285-287	3
α-helix	288-291	4
α-helix	292-294	3
α-helix	300-303	4
α-helix	308-311	4
α-helix	318-326	9
α-helix	333-350	18
α-helix	356-373	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain testis-specific protein	A, B	protein	126	MUS MUSCULUS	Q91Y44 (AlphaFold model)
Histone H3	P, Q	protein	10	MUS MUSCULUS	P68433 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2WP1_1 BROMODOMAIN TESTIS-SPECIFIC PROTEIN (chains A, B)
QQQHKVLKTVKVTEQLKHCSEILKEMLAKKHLPYAWPFYNPVDADALGLHNYYDVVKNPM
DLGTIKGKMDNQEYKDAYEFAADVRLMFMNCYKYNPPDHEVVAMARTLQDVFELHFAKIP
DEPIES

Sequence of entity 2 (P, Q), FASTA

>2WP1_2 HISTONE H3 (chains P, Q)
KAPRKQLATK

Primary citation

Cooperative Binding of Two Acetylation Marks on a Histone Tail by a Single Bromodomain. Moriniere, J., Rousseaux, S., Steuerwald, U. et al. Nature (2009) 461:664. DOI 10.1038/NATURE08397 · PubMed

Other PDB entries of the same protein (UniProt Q91Y44 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WP2 2.37 Å, Structure of Brdt bromodomain BD1 bound to a diacetylated histone H4 peptide.

Browse structure collections

About this viewer

MolViewer shows 2WP1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.