2WWU: Catalytic domain of PHD finger protein 8

Crystal structure of the catalytic domain of PHD finger protein 8. Determined by X-ray diffraction at 2.15 Å resolution. Released 17 Nov 2009.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 3,159
Mol. weight: 44.35 kDa
Ligands: BGC, NI
Released: 17 Nov 2009

Explore 2WWU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WWU contains 20 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	85-93	9
β-strand	97-98	2	1
α-helix	99-101	3
β-strand	104	1	1
α-helix	113-119	7
β-strand	125-127	3	1
β-strand	136	1	2
α-helix	144-151	8
β-strand	156-161	6	1
β-strand	167-171	5	1
α-helix	172-181	10
β-strand	188-194	7	1
α-helix	199-203	5
β-strand	205	1	2
α-helix	208-213	6
α-helix	215-219	5
α-helix	227-229	3
β-strand	234-238	5	1
β-strand	242-247	6	1
α-helix	248-249	2
α-helix	250-252	3
β-strand	254-269	16	1
α-helix	273-284	12
α-helix	288-290	3
α-helix	293-296	4
β-strand	301-306	6	1
β-strand	310-313	4	1
β-strand	318-334	17	1
α-helix	340-353	14
α-helix	364-384	21
α-helix	391-407	17
α-helix	413-415	3
α-helix	417-419	3
α-helix	426-438	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phd finger protein 8	A	protein	371	HOMO SAPIENS	Q9UPP1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WWU_1 PHD FINGER PROTEIN 8 (chains A)
SMPVKTGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMT
LPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGKREKVLNVISLEFS
DTRLSNLVETPKIVRKLSWVENLWPEECVFERPNVQKYCLMSVRDSYTDFHIDFGGTSVW
YHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKCYKCSVKQGQTLFIPTG
WIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHIL
DIFRGLRENRRHPASYLVHGGKALNLAFRAWTRKEALPDHEDEIPETVRTVQLIKDLARE
IRLVEDIFQQN

Ligands and cofactors

ID	Name	Formula	Copies
BGC	beta-D-glucopyranose	C6 H12 O6	2
NI	Nickel (II) ion	Ni	1

Water and common crystallization additives (ACT, SO4) are not listed.

Primary citation

Crystal structure of the PHF8 Jumonji domain, an Nepsilon-methyl lysine demethylase. Yue, W.W., Hozjan, V., Ge, W. et al. FEBS Lett (2010) 584:825-830. DOI 10.1016/j.febslet.2009.12.055 · PubMed

Other PDB entries of the same protein (UniProt Q9UPP1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7CMZ 1.7 Å, Crystal Structure of BRCT7/8 in Complex with the APS Motif of PHF8
3K3O 2.1 Å, Crystal structure of the catalytic core domain of human PHF8 complexed with…
3KV4 2.19 Å, Structure of PHF8 in complex with histone H3
3K3N 2.4 Å, Crystal structure of the catalytic core domain of human PHF8
4DO0 2.55 Å, Crystal Structure of human PHF8 in complex with Daminozide

Browse structure collections

About this viewer

MolViewer shows 2WWU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.