2WXW: Human angiotensinogen

Crystal structure of human angiotensinogen. Determined by X-ray diffraction at 3.3 Å resolution. Released 20 Oct 2010.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 3,383
Mol. weight: 49.9 kDa
Released: 20 Oct 2010

Explore 2WXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WXW contains 17 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	1
α-helix	15-24	10
β-strand	33-34	2	2
α-helix	35-37	3
β-strand	38	1	3
α-helix	43-46	4
α-helix	48-60	13
α-helix	64-84	21
α-helix	85-87	3
β-strand	97	1	4
β-strand	100-101	2	5
α-helix	103-115	13
α-helix	121-129	9
β-strand	142	1	1
α-helix	144-158	15
β-strand	170-179	10	4
α-helix	180-181	2
β-strand	186-187	2	2
α-helix	188-197	10
β-strand	201-203	3	4
β-strand	205	1	3
α-helix	211-226	16
β-strand	244-255	12	4
β-strand	258-260	3	6
β-strand	267	1	7
β-strand	275	1	7
β-strand	280-287	8	6
β-strand	288-289	2	5
β-strand	296-300	5	5
β-strand	303	1	5
β-strand	307-314	8	5
α-helix	320-325	6
α-helix	332-335	4
β-strand	341-348	8	6
α-helix	349-351	3
β-strand	352-358	7	4
α-helix	359-362	4
α-helix	369-373	5
β-strand	392-401	10	4
β-strand	419-422	4	6
β-strand	427-433	7	5
β-strand	438-439	2	5
β-strand	442-445	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Angiotensinogen	A	protein	453	HOMO SAPIENS	P01019 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2WXW_1 ANGIOTENSINOGEN (chains A)
SDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVA
AKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALD
HTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVF
TAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASV
DSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVT
QVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDL
QDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQLNKPEVL
EVTLNRPFLFAVYDQSATALHFLGRVANPLSTA

Primary citation

A Redox Switch in Angiotensinogen Modulates Angiotensin Release. Zhou, A., Carrell, R.W., Murphy, M.P. et al. Nature (2010) 468:108. DOI 10.1038/NATURE09505 · PubMed

Other PDB entries of the same protein (UniProt P01019 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NJ9 1.25 Å, E. coli Microcin-processing metalloprotease TldD/E with DRVY angiotensin fragment bound
5NJA 1.4 Å, E. coli Microcin-processing metalloprotease TldD/E with angiotensin analogue bound
3WOO 1.8 Å, Crystal structure of the DAP BII hexapeptide complex I
4AA1 1.99 Å, Crystal structure of ANCE in complex with Angiotensin-II
4APH 1.99 Å, Human angiotensin-converting enzyme in complex with angiotensin-II
4FYS 2.01 Å, Human aminopeptidase N (CD13) in complex with angiotensin IV
3WOR 2.1 Å, Crystal structure of the DAP BII octapeptide complex
5M3Y 2.3 Å, Crystal structure of human glycosylated angiotensinogen
5E2Q 2.4 Å, Structure of human DPP3 in complex with angiotensin-II
6I3F 2.55 Å, Crystal structure of the complex of human angiotensinogen and renin at 2.55 Angstrom
5M3X 2.63 Å, Crystal structure of human angiotensin I-deleted angiotensinogen
6OS0 2.9 Å, Structure of synthetic nanobody-stabilized angiotensin II type 1 receptor bound to…

Browse structure collections

About this viewer

MolViewer shows 2WXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.