Crystal structure of the extracellular domain of human Vasoactive intestinal polypeptide receptor 2. Determined by X-ray diffraction at 2.1 Å resolution. Released 9 Mar 2010.
Explore 2X57 in 3D Show helices and sheets RCSB PDB PDBe
2X57 contains 17 α-helices and 32 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -8-44 | 28 | |
| β-strand | 52 | 1 | 1 |
| β-strand | 55-57 | 3 | 2 |
| β-strand | 60-62 | 3 | 2 |
| β-strand | 65 | 1 | 1 |
| β-strand | 70-74 | 5 | 3 |
| α-helix | 75-76 | 2 | |
| α-helix | 77-82 | 6 | |
| β-strand | 83 | 1 | 4 |
| β-strand | 88-92 | 5 | 3 |
| β-strand | 93-94 | 2 | 5 |
| β-strand | 97-98 | 2 | 5 |
| α-helix | 99-101 | 3 | |
| β-strand | 102 | 1 | 3 |
| α-helix | 105-109 | 5 | |
| β-strand | 111 | 1 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -13--10 | 4 | |
| α-helix | -8--2 | 7 | |
| α-helix | 26-44 | 19 | |
| α-helix | 46-48 | 3 | |
| β-strand | 52 | 1 | 6 |
| β-strand | 55-57 | 3 | 7 |
| β-strand | 60-62 | 3 | 7 |
| β-strand | 65 | 1 | 6 |
| β-strand | 70-74 | 5 | 8 |
| α-helix | 75-76 | 2 | |
| α-helix | 77-82 | 6 | |
| β-strand | 83 | 1 | 9 |
| β-strand | 88-92 | 5 | 8 |
| β-strand | 93-94 | 2 | 10 |
| β-strand | 97-98 | 2 | 10 |
| α-helix | 99-100 | 2 | |
| α-helix | 105-109 | 5 | |
| β-strand | 111 | 1 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -8-44 | 28 | |
| β-strand | 52 | 1 | 11 |
| β-strand | 55-57 | 3 | 12 |
| β-strand | 60-62 | 3 | 12 |
| β-strand | 65 | 1 | 11 |
| β-strand | 70-74 | 5 | 13 |
| α-helix | 77-82 | 6 | |
| β-strand | 83 | 1 | 14 |
| β-strand | 88-92 | 5 | 13 |
| β-strand | 93-94 | 2 | 15 |
| β-strand | 97-98 | 2 | 15 |
| α-helix | 99-101 | 3 | |
| β-strand | 102 | 1 | 13 |
| α-helix | 105-109 | 5 | |
| β-strand | 111 | 1 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vasoactive intestinal polypeptide receptor 2 | A, B, C | protein | 116 | HOMO SAPIENS | P41587 (AlphaFold model) |
>2X57_1 VASOACTIVE INTESTINAL POLYPEPTIDE RECEPTOR 2 (chains A, B, C) MHHHHHHSSGVDLGTENLYFQSMRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCW RPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDES
Crystal Structure of the Extracellular Domain of Human Vasoactive Intestinal Polypeptide Receptor 2. Pike, A.C.W., Barr, A.J., Quigley, A. et al. To be published.
Other PDB entries of the same protein (UniProt P41587 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2X57 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.