2X6U: Human TBX5 in the DNA-free form

Crystal structure of human TBX5 in the DNA-free form. Determined by X-ray diffraction at 1.9 Å resolution. Released 28 Apr 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,653
Mol. weight: 23.86 kDa
Ligands: MG, PE4
Released: 28 Apr 2010

Explore 2X6U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X6U contains 6 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	55-58	4	1
α-helix	61-70	10
β-strand	73-75	3	2
β-strand	77	1	3
β-strand	81-82	2	3
β-strand	88-92	5	1
β-strand	99-117	19	2
β-strand	120-126	7	2
α-helix	127-129	3
β-strand	136-137	2	2
β-strand	143-144	2	2
α-helix	145-150	6
β-strand	153-154	2	1
β-strand	159-161	3	3
α-helix	170	1
β-strand	171-172	2	3
β-strand	177-187	11	2
β-strand	201-204	4	2
α-helix	207-209	3
β-strand	211-214	4	2
α-helix	220-229	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-box transcription factor TBX5	A	protein	203	HOMO SAPIENS	Q99593 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2X6U_1 T-BOX TRANSCRIPTION FACTOR TBX5 (chains A)
GAMEGIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVP
ADDHRYKFADNKWSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPF
GHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIE
NNPFAKGFRGSDDMELHRMSRMQ

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
PE4	2-{2-[2-(2-{2-[2-(2-ethoxy-ethoxy)-ethoxy]-ethoxy}-ethoxy)-ethoxy]-ethoxy}-etha…	C16 H34 O8	1

Primary citation

Structural Basis of Tbx5-DNA Recognition: The T-Box Domain in its DNA-Bound and -Unbound Form. Stirnimann, C.U., Ptchelkine, D., Grimm, C. et al. J Mol Biol (2010) 400:71. DOI 10.1016/J.JMB.2010.04.052 · PubMed

Other PDB entries of the same protein (UniProt Q99593 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2X6V 2.2 Å, Crystal structure of human TBX5 in the DNA-bound and DNA-free form
5BQD 2.58 Å, Crystal Structure of TBX5 (1-239) Dimer
4S0H 2.82 Å, TBX5 DB, NKX2.5 HD, ANF DNA Complex

Browse structure collections

About this viewer

MolViewer shows 2X6U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.