2XB0: Chromo domain-containing protein 1

DNA-binding domain from Saccharomyces cerevisiae chromatin- remodelling protein Chd1. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 May 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 1
Atoms: 1,981
Mol. weight: 30.57 kDa
Released: 11 May 2011

Explore 2XB0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XB0 contains 11 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain X: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
α-helix	28-33	6
α-helix	42-87	46
α-helix	100-108	9
β-strand	115-116	2	1
β-strand	124-125	2	1
α-helix	126-146	21
α-helix	151-153	3
α-helix	161-163	3
α-helix	173-186	14
α-helix	191-196	6
α-helix	203-205	3
α-helix	246-260	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromo domain-containing protein 1	X	protein	270	SACCHAROMYCES CEREVISIAE	P32657 (AlphaFold model)

Sequence of entity 1 (X), FASTA

>2XB0_1 CHROMO DOMAIN-CONTAINING PROTEIN 1 (chains X)
GPLGSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCV
HEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKG
VKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLL
IGVFKYGYGSWTQIRDDPFLGITDKIFLNEVHNPVAKKSASSSDTTPTPSKKGKGITGSS
KKVPGAIHLGRRVDYLLSFLRGGLNTKSPS

Primary citation

The DNA-Binding Domain of the Chd1 Chromatin- Remodelling Enzyme Contains Sant and Slide Domains. Ryan, D.P., Sundaramoorthy, R., Martin, D. et al. EMBO J (2011) 30:2596. DOI 10.1038/EMBOJ.2011.166 · PubMed

Other PDB entries of the same protein (UniProt P32657 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TED 2.0 Å, Crystal structure of the Chd1 DNA-binding domain in complex with a DNA duplex
2H1E 2.2 Å, Tandem chromodomains of budding yeast CHD1
7TN2 2.3 Å, Composite model of a Chd1-nucleosome complex in the nucleotide-free state derived from…
9N6H 2.54 Å, 2.54 A S.cerevisiae Chd1[L886G/L889G/L891G]-nucleosome 1:1 complex
9N6I 2.61 Å, 2.61 A S.cerevisiae Chd1[L886G/L889G/L891G]-nucleosome 2:1 complex
7NKX 2.9 Å, RNA polymerase II-Spt4/5-nucleosome-Chd1 structure
9N6K 2.9 Å, 2.88 A S.cerevisiae Chd1[L886G/L889G/L891G]-nucleosome 2:1 complex with DNA-binding domain
5J70 2.96 Å, The Chd1 DNA-binding domain in complex with 17mer DNA duplex
9GD3 3.0 Å, Structure of a mononucleosome bound by one copy of Chd1 with the DBD on the exit-side DNA.
3MWY 3.7 Å, Crystal structure of the chromodomain-ATPase portion of the yeast Chd1 chromatin remodeler
9R5S 3.8 Å, Structural characterisation of chromatin remodelling intermediates supports linker DNA…
9GD1 4.0 Å, Structure of Chd1 bound to a hexasome-nucleosome complex with a dyad-to-dyad distance of…

Browse structure collections

About this viewer

MolViewer shows 2XB0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.