Crystal structure of the human Pygo2 PHD finger in complex with the B9L HD1 domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 28 Jul 2010.
Explore 2XB1 in 3D Show helices and sheets RCSB PDB PDBe
2XB1 contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 329 | 1 | 1 |
| β-strand | 336 | 1 | 1 |
| β-strand | 343-345 | 3 | 2 |
| β-strand | 353-355 | 3 | 2 |
| α-helix | 356-358 | 3 | |
| α-helix | 363-371 | 9 | |
| β-strand | 375-377 | 3 | 3 |
| α-helix | 380-384 | 5 | |
| β-strand | 236-238 | 3 | 3 |
| α-helix | 240-251 | 12 | |
| α-helix | 258-265 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 329 | 1 | 4 |
| β-strand | 336 | 1 | 4 |
| β-strand | 343-345 | 3 | 5 |
| β-strand | 353-355 | 3 | 5 |
| α-helix | 356-358 | 3 | |
| α-helix | 363-370 | 8 | |
| β-strand | 375-377 | 3 | 6 |
| α-helix | 380-385 | 6 | |
| β-strand | 236-238 | 3 | 6 |
| α-helix | 240-251 | 12 | |
| α-helix | 258-265 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pygopus homolog 2, B-cell cll/lymphoma 9-like protein | A, C | protein | 105 | HOMO SAPIENS | Q86UU0 (AlphaFold model), Q9BRQ0 (AlphaFold model) |
>2XB1_1 PYGOPUS HOMOLOG 2, B-CELL CLL/LYMPHOMA 9-LIKE PROTEIN (chains A, C) GLVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCLK TKEGSGSGSGSQFVYVFTTHLANTAAEAVLQGRADSILAYHQQNV
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Water and common crystallization additives (PEG, GOL) are not listed.
Allosteric Remodeling of the Histone H3 Binding Pocket in the Pygo2 Phd Finger Triggered by its Binding to the B9L/Bcl9 Co-Factor. Miller, T.C., Rutherford, T.J., Johnson, C.M. et al. J Mol Biol (2010) 401:969. DOI 10.1016/J.JMB.2010.07.007 · PubMed
Other PDB entries of the same protein (UniProt Q86UU0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2XB1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.