2XC7: PHAX-RBD

Solution Structure of PHAX-RBD in complex with ssRNA. Determined by solution NMR. Released 28 Apr 2010.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 2
Atoms: 911
Mol. weight: 13.07 kDa
Released: 28 Apr 2010

Explore 2XC7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XC7 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	8-18	11
α-helix	24-34	11
α-helix	36-52	17
α-helix	66-76	11
α-helix	82-85	4
α-helix	86-90	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphorylated adapter RNA export protein	A	protein	104	HOMO SAPIENS	Q9H814 (AlphaFold model)
5'-(apupcp*gp)-3'	P	RNA	4

Sequence of entity 1 (A), FASTA

>2XC7_1 PHOSPHORYLATED ADAPTER RNA EXPORT PROTEIN (chains A)
GAMAEDSQEKVADEISFRLQEPKKDLIARVVRIIGNKKAIELLMETAEVEQNGGLFIMNG
SRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAAR

Sequence of entity 2 (P), FASTA

>2XC7_2 5'-(AP*UP*CP*GP)-3' (chains P)
AUCG

Primary citation

Structure and RNA Recognition by the Snrna and Snorna Transport Factor Phax. Mourao, A., Varrot, A., Mackereth, C.D. et al. RNA (2010) 16:1205. DOI 10.1261/RNA.2009910 · PubMed

Other PDB entries of the same protein (UniProt Q9H814 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HFL 2.62 Å, Cryo-EM structure of the human snRNA export complex comprising CBC-PHAX-CRM1-RanGTP and…
8PNT 3.46 Å, Structure of the human nuclear cap-binding complex bound to PHAX and m7G-capped RNA

Browse structure collections

About this viewer

MolViewer shows 2XC7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.