Crystal structure of the extracellular domain of human growth hormone releasing hormone receptor. Determined by X-ray diffraction at 1.95 Å resolution. Released 16 Jun 2010.
Explore 2XDG in 3D Show helices and sheets RCSB PDB PDBe
2XDG contains 14 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 34-45 | 12 | |
| β-strand | 55 | 1 | 1 |
| β-strand | 58-59 | 2 | 2 |
| β-strand | 64-65 | 2 | 2 |
| α-helix | 66-67 | 2 | |
| β-strand | 68 | 1 | 1 |
| β-strand | 72-76 | 5 | 3 |
| α-helix | 77-79 | 3 | |
| α-helix | 80-84 | 5 | |
| β-strand | 92-97 | 6 | 3 |
| β-strand | 100-101 | 2 | 3 |
| β-strand | 105 | 1 | 3 |
| α-helix | 108-111 | 4 | |
| α-helix | 116-119 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 34-46 | 13 | |
| β-strand | 55 | 1 | 4 |
| β-strand | 58-59 | 2 | 5 |
| β-strand | 64-65 | 2 | 5 |
| α-helix | 66-67 | 2 | |
| β-strand | 68 | 1 | 4 |
| β-strand | 72-76 | 5 | 6 |
| α-helix | 77-79 | 3 | |
| α-helix | 80-84 | 5 | |
| β-strand | 92-97 | 6 | 6 |
| β-strand | 100-101 | 2 | 6 |
| α-helix | 102-104 | 3 | |
| β-strand | 105 | 1 | 6 |
| α-helix | 108-111 | 4 | |
| α-helix | 113-115 | 3 | |
| α-helix | 116-118 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Growth hormone-releasing hormone receptor | A, B | protein | 92 | HOMO SAPIENS | Q02643 (AlphaFold model) |
>2XDG_1 GROWTH HORMONE-RELEASING HORMONE RECEPTOR (chains A, B) SMLREDESACLQAAEEMPQTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGA VKRDCTITGWSEPFPPYPVACPVPLELLAEEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 3 |
Water and common crystallization additives (EDO) are not listed.
Crystal Structure of the Extracellular Domain of Human Growth Hormone Releasing Hormone Receptor. Pike, A.C.W., Quigley, A., Barr, A.J. et al. To be published.
Other PDB entries of the same protein (UniProt Q02643 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2XDG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.