2XFV: Regulatory protein SWI6

Structure of the amino-terminal domain from the cell-cycle regulator Swi6. Determined by X-ray diffraction at 1.9 Å resolution. Released 23 Jun 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 2,196
Mol. weight: 29.63 kDa
Ligands: CAC, CA
Released: 23 Jun 2010

Explore 2XFV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XFV contains 14 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	1
β-strand	16-23	8	1
β-strand	29-30	2	1
α-helix	32-34	3
α-helix	35-44	10
α-helix	47-49	3
α-helix	58-68	11
β-strand	73-74	2	1
β-strand	80-82	3	1
α-helix	84-93	10
α-helix	101-103	3
β-strand	104-106	3	2
α-helix	107-108	2

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	3
β-strand	16-23	8	3
β-strand	29-30	2	3
α-helix	32-34	3
α-helix	35-44	10
α-helix	47-49	3
α-helix	58-67	10
β-strand	73-74	2	3
β-strand	80-82	3	3
α-helix	84-93	10
α-helix	97-100	4
α-helix	101-103	3
β-strand	104-106	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulatory protein SWI6	A, B	protein	125	SACCHAROMYCES CEREVISIAE	P09959 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2XFV_1 REGULATORY PROTEIN SWI6 (chains A, B)
ALEEVVRYLGPHNEIPLTLTRDSETGHFLLKHFLPILQQYHDTGNINETNPDSFPTDEER
NKLLAHYGIAVNTDDRGELWIELEKCLQLLNMLNLFGLFQDAFEFEEPETDQDEEDPSHS
KLPEN

Ligands and cofactors

ID	Name	Formula	Copies
CAC	Cacodylate ion	C2 H6 As O2	1
CA	Calcium ion	Ca	3

Water and common crystallization additives (ACT, GOL) are not listed.

Primary citation

Structure of the Amino-Terminal Domain from the Cell-Cycle Regulator Swi6S. Taylor, I.A., Goldstone, D.C., Pala, P. et al. Proteins (2010) 78:2861. DOI 10.1002/PROT.22795 · PubMed

Other PDB entries of the same protein (UniProt P09959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XW5 1.85 Å, Crystal structure of budding yeast Cdc14p (C283S) bound to a Swi6p phosphopeptide
1SW6 2.1 Å, S. Cerevisiae SWI6 ankyrin-repeat fragment

Browse structure collections

About this viewer

MolViewer shows 2XFV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.