2XFX: MHC class 1

cattle MHC class I N01301 presenting an 11mer from Theileria parva. Determined by X-ray diffraction at 1.9 Å resolution. Released 27 Oct 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: BOS TAURUS, THEILERIA PARVA
Chains: 3
Atoms: 3,341
Mol. weight: 45.27 kDa
Released: 27 Oct 2010

Explore 2XFX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XFX contains 13 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-12	10	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-54	5
α-helix	57-84	28
β-strand	94-103	10	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-149	12
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-174	10
α-helix	176-179	4
β-strand	183	1	2
α-helix	184-185	2
β-strand	186-193	8	3
β-strand	198-208	11	3
β-strand	209	1	2
β-strand	214-218	5	4
β-strand	223	1	4
β-strand	229-230	2	3
α-helix	231-233	3
β-strand	234-235	2	3
β-strand	241-250	10	3
α-helix	254-256	3
β-strand	258-262	5	4
β-strand	270-272	3	4

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	5
α-helix	5-6	2
β-strand	7-12	6	6
β-strand	22-31	10	6
β-strand	32	1	5
β-strand	37-42	6	7
β-strand	45-46	2	7
β-strand	50-51	2	6
α-helix	52-54	3
β-strand	55-56	2	6
β-strand	62-70	9	6
β-strand	78-83	6	7
β-strand	91-94	4	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class 1	A	protein	277	BOS TAURUS	Q30291 (AlphaFold model)
Beta-2-microglobulin	B	protein	99	BOS TAURUS	P01888 (AlphaFold model)
Uncharacterized protein	C	protein	11	THEILERIA PARVA	Q4MYJ2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XFX_1 MHC CLASS 1 (chains A)
GSHSLRYFHTAVSRPGLREPLFITVGYVDDTQFVRFDSDARDPRTEPRQPWMEKEGPEYW
DRETQISKENALWYREALNNLRGYYNQSEAGSHTLQEMYGCDVGSDGRLRRGYEQYGYDG
RDYLALNEDLRSWTAADTAAQISKRKMEAAGAAERFRNYLEGTCVEWLRRYLENGKDTLL
RADPPKAHVTRHPSSEHEVTLRCWALGFYPEEISLTWQRNGEDQTQDMELVETRPSGDGN
FQKWAALVVPSGEEQRYTCRVQHEGLQEPLTLRWEPG

Sequence of entity 2 (B), FASTA

>2XFX_2 BETA-2-MICROGLOBULIN (chains B)
AIQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDW
SFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Sequence of entity 3 (C), FASTA

>2XFX_3 UNCHARACTERIZED PROTEIN (chains C)
VGYPKVKEEML

Primary citation

Mhc Class I Bound to an Immunodominant Theileria Parva Epitope Demonstrates Unconventional Presentation to T Cell Receptors. Macdonald, I.K., Harkiolaki, M., Hunt, L. et al. PLoS Pathog (2010) 6:01149. DOI 10.1371/JOURNAL.PPAT.1001149 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2XFX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.