2XQB: Anti-IL-15 Antibody

Crystal Structure of anti-IL-15 Antibody in Complex with human IL-15. Determined by X-ray diffraction at 2.6 Å resolution. Released 29 Dec 2010.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,063
Mol. weight: 61.38 kDa
Released: 29 Dec 2010

Explore 2XQB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XQB contains 18 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-15	12
β-strand	25-27	3	1
α-helix	33-35	3
α-helix	36-53	18
α-helix	58-74	17
α-helix	85-87	3
α-helix	88-90	3
β-strand	92-94	3	1
α-helix	96-111	16

Chain H: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	2
β-strand	10-12	3	3
β-strand	18-25	8	2
α-helix	29-31	3
β-strand	33-39	7	3
β-strand	45-52	8	3
β-strand	57-59	3	3
β-strand	67-72	6	2
β-strand	77-82	6	2
α-helix	84-86	3
β-strand	88-95	8	3
α-helix	100-100E	6
β-strand	103	1	3
β-strand	107-111	5	3
β-strand	117	1	4
β-strand	120-124	5	5
β-strand	135-145	11	5
β-strand	146	1	4
β-strand	151-154	4	6
α-helix	155-157	3
β-strand	162-165	4	5
α-helix	166-168	3
β-strand	169-170	2	5
β-strand	176-185	10	5
β-strand	194-200	7	6
α-helix	201-203	3
β-strand	205-211	7	6

Chain L: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	4	7
β-strand	19-24	6	8
β-strand	33-38	6	7
β-strand	45-48	4	7
β-strand	49	1	9
β-strand	53	1	9
β-strand	62-66	5	8
β-strand	70-75	6	8
α-helix	80-82	3
β-strand	84-92	9	7
β-strand	95B-98	4	7
β-strand	102-106	5	7
β-strand	111	1	10
β-strand	114-118	5	11
α-helix	119-121	3
α-helix	122-125	4
β-strand	130-139	10	11
β-strand	140	1	10
β-strand	145-150	6	12
β-strand	153-155	3	12
β-strand	159-161	3	11
α-helix	162-164	3
β-strand	165	1	13
β-strand	172	1	11
β-strand	173	1	13
β-strand	174-180	7	11
α-helix	182-186	5
β-strand	191-197	7	12
β-strand	200-206	7	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin 15	A	protein	114	Homo sapiens	P40933 (AlphaFold model)
Anti-il-15 antibody	H	protein	236	Homo sapiens
Anti-il-15 antibody	L	protein	211	Homo sapiens

Sequence of entity 1 (A), FASTA

>2XQB_1 INTERLEUKIN 15 (chains A)
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIH
DTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Sequence of entity 2 (H), FASTA

>2XQB_2 ANTI-IL-15 ANTIBODY (chains H)
QVQLVQSGAEVKKPGASVKVSCKASGYSFSSFGISWVRQAPGQGLEWLGWISAFNGYTKY
AQKFQDRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPAAWPLQQSLAWFDPWGQGTM
VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA
VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHQYVL

Sequence of entity 3 (L), FASTA

>2XQB_3 ANTI-IL-15 ANTIBODY (chains L)
TQPPSASGTPGQRVTISCSGSTSNLKRNYVYWYQQLPGTAPKLLIYRDRRRPSGVPDRFS
GSKSGTSASLAISGLRSEDEADYYCAWYDRELSEWVFGGGTKLTVLQPKAAPSVTLFPPS
SEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLT
PEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Primary citation

Engineering a High Affinity Anti-Il-15 Antibody: Crystal Structure Reveals an Alpha-Helix in Vh Cdr3 as Key Component of Paratope. Lowe, D.C., Gerhardt, S., Ward, A. et al. J Mol Biol (2011) 406:160. DOI 10.1016/J.JMB.2010.12.017 · PubMed

Other PDB entries of the same protein (UniProt P40933 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z3Q 1.85 Å, Crystal structure of the IL-15/IL-15Ra complex
2Z3R 2.0 Å, Crystal structure of the IL-15/IL-15Ra complex
4GS7 2.35 Å, Structure of the Interleukin-15 quaternary complex

Browse structure collections

About this viewer

MolViewer shows 2XQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.