2XQQ: Human dynein light chain

Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide (Ac-SRGTQTE). Determined by X-ray diffraction at 1.31 Å resolution. Released 4 May 2011.

Method: X-ray diffraction
Resolution: 1.31 Å
Organisms: HOMO SAPIENS, SYNTHETIC CONSTRUCT
Chains: 8
Atoms: 3,601
Mol. weight: 44.8 kDa
Released: 4 May 2011

Explore 2XQQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XQQ contains 9 α-helices and 22 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	1
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-66	13	1
β-strand	72-78	7	1
β-strand	81-87	7	1

Chain B: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6-13	8	2
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-59	6	2
β-strand	63-66	4	3
β-strand	72-78	7	2
β-strand	81-87	7	2

Chain D: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-13	7	4
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-59	6	4
β-strand	63-66	4	5
β-strand	72-78	7	4
β-strand	81-87	7	4

Chains E, F, G and H: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-5	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 2, cytoplasmic	A, B, C, D	protein	89	HOMO SAPIENS	Q96FJ2 (AlphaFold model)
Sac-arg-gly-thr-gln-thr-glu	E, F, G, H	protein	7	SYNTHETIC CONSTRUCT

Sequence of entity 1 (A, B, C, D), FASTA

>2XQQ_1 DYNEIN LIGHT CHAIN 2, CYTOPLASMIC (chains A, B, C, D)
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG

Sequence of entity 2 (E, F, G, H), FASTA

>2XQQ_2 SAC-ARG-GLY-THR-GLN-THR-GLU (chains E, F, G, H)
SRGTQTE

Primary citation

Directed Evolution Reveals the Binding Motif Preference of the Lc8/Dynll Hub Protein and Predicts Large Numbers of Novel Binders in the Human Proteome. Rapali, P., Radnai, L., Suveges, D. et al. PLoS One (2011) 6:18818. DOI 10.1371/JOURNAL.PONE.0018818 · PubMed

Other PDB entries of the same protein (UniProt Q96FJ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4D07 1.85 Å, DYNLL2 dynein light chain binds to an extended, unstructured linear motif of myosin 5a…
7CNU 2.0 Å, Crystal structure of DLC2 in complex with BMF peptide
3P8M 2.9 Å, Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized…

Browse structure collections

About this viewer

MolViewer shows 2XQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.