2XUB: Human RPC62 subunit structure

Name: PDB 2XUB: Human RPC62 subunit structure
Published: 2011-03-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Human RPC62 subunit structure. Determined by X-ray diffraction at 2.8 Å resolution. Released 2 Mar 2011.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 3,449
Mol. weight: 60.69 kDa
Released: 2 Mar 2011

Explore 2XUB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2XUB contains 22 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	3-31	29
β-strand	34-35	2	1
α-helix	36-43	8
α-helix	47-59	13
β-strand	63-68	6	1
β-strand	72-77	6	1
α-helix	79-83	5
α-helix	84-87	4
α-helix	88-113	26
β-strand	116	1	2
α-helix	118-131	14
α-helix	141-153	13
β-strand	157-159	3	2
α-helix	160-161	2
β-strand	235-237	3	2
α-helix	239-258	20
α-helix	261-272	12
β-strand	284	1	3
α-helix	285-287	3
β-strand	288-289	2	4
α-helix	290-295	6
α-helix	305-316	12
β-strand	323-325	3	4
β-strand	333-336	4	4
β-strand	337	1	3
α-helix	338-358	21
α-helix	360-371	12
α-helix	377-384	8
α-helix	388-400	13
α-helix	428-456	29
α-helix	458-472	15
α-helix	485-488	4
α-helix	493-529	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase III subunit RPC3	A	protein	534	HOMO SAPIENS	Q9BUI4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2XUB_1 DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC3 (chains A)
MTQAEIKLCSLLLQEHFGEIVEKIGVHLIRTGSQPLRVIAHDTGTSLDQVKKALCVLVQH
NLVSYQVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYSDTGELIVEELLLNGKLTMSA
VVKKVADRLTETMEDGKTMDYAEVSNTFVRLADTHFVQRCPSVPTTENSDPGPPPPAPTL
VINEKDMYLVPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANLD
RFHQHFRDQAIVSAVANRMDQTSSEIVRTMLRMSEITTSSSAPFTQPLSSNEIFRSLPVG
YNISKQVLDQYLTLLADDPLEFVGKSGDSGGGMYVINLHKALASLATATLESVVQERFGS
RCARIFRLVLQKKHIEQKQVEDFAMIPAKEAKDMLYKMLSENFMSLQEIPKTPDHAPSRT
FYLYTVNILSAARMLLHRCYKSIANLIERRQFETKENKRLLEKSQRVEAIIASMQATGAE
EAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQVDETIFLLESYIECTMKRQ

Primary citation

Structure-Function Analysis of Hrpc62 Provides Insights Into RNA Polymerase III Transcription. Lefevre, S., Dumay-Odelot, H., El Ayoubi, L. et al. Nat Struct Mol Biol (2011) 18:352. DOI 10.1038/NSMB.1996 · PubMed

Other PDB entries of the same protein (UniProt Q9BUI4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AE1 2.8 Å, Cryo-EM structure of human RNA Polymerase III elongation complex 1
9K39 2.8 Å, Human RNA Polymerase III de novo transcribing complex 8 (TC8)
7D58 2.9 Å, cryo-EM structure of human RNA polymerase III in elongating state
9K36 2.9 Å, Human RNA Polymerase III de novo transcribing complex 12 (TC12)
2XV4 2.95 Å, Structure of Human RPC62 (partial)
9K2G 3.0 Å, Human RNA Polymerase III de novo transcribing complex 13 (TC13)
9K3U 3.0 Å, Human RNA Polymerase III de novo transcribing complex 5 (TC5)
7AE3 3.1 Å, Cryo-EM structure of human RNA Polymerase III elongation complex 3
7D59 3.1 Å, cryo-EM structure of human RNA polymerase III in apo state
9K38 3.1 Å, Human RNA Polymerase III de novo transcribing complex 6 (TC6)
9FSO 3.28 Å, Human RNA Polymerase III Class III Open Pre-initiation Complex 1 (OC1)
7A6H 3.3 Å, Cryo-EM structure of human apo RNA Polymerase III

Browse structure collections

About this viewer

MolViewer shows 2XUB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.