2Y43: Rad18 ubiquitin ligase RING domain structure

Name: PDB 2Y43: Rad18 ubiquitin ligase RING domain structure
Published: 2011-05-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Rad18 ubiquitin ligase RING domain structure. Determined by X-ray diffraction at 1.8 Å resolution. Released 11 May 2011.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,527
Mol. weight: 23.01 kDa
Ligands: ZN
Released: 11 May 2011

Explore 2Y43 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y43 contains 9 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	11-16	6
α-helix	17-22	6
β-strand	24	1	1
β-strand	31	1	1
β-strand	35-37	3	2
β-strand	44-46	3	2
α-helix	47-54	8
β-strand	59	1	3
β-strand	66	1	3
α-helix	69-71	3
β-strand	73-74	2	2
α-helix	76-90	15

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	16-22	7
β-strand	24	1	4
β-strand	31	1	4
β-strand	35-37	3	5
β-strand	44-46	3	5
α-helix	47-54	8
β-strand	59	1	6
β-strand	66	1	6
α-helix	69-71	3
β-strand	73-74	2	5
α-helix	76-93	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase RAD18	A, B	protein	99	HOMO SAPIENS	Q9NS91 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2Y43_1 E3 UBIQUITIN-PROTEIN LIGASE RAD18 (chains A, B)
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQC
PTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALES

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Symmetry and Asymmetry of the Ring-Ring Dimer of Rad18. Huang, A., Hibbert, R.G., De Jong, R.N. et al. J Mol Biol (2011) 410:424. DOI 10.1016/J.JMB.2011.04.051 · PubMed

Other PDB entries of the same protein (UniProt Q9NS91 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IR4 1.62 Å, Crystal structure of the SLF1 BRCT domain in complex with a Rad18 peptide containing pS442
8IR2 1.75 Å, Crystal structure of the SLF1 BRCT domain in complex with a Rad18 peptide containing…
2YBF 2.0 Å, Complex of Rad18 (Rad6 binding domain) with Rad6b
9BD3 2.58 Å, Structure of the MAGEA4 MHD-RAD18 R6BD Complex
2MRE NMR structure of the Rad18-UBZ/ubiquitin complex
2MRF NMR structure of the ubiquitin-binding zinc finger (UBZ) domain from human Rad18
5VF0 Solution NMR structure of human RAD18 (198-240) in complex with ubiquitin

Browse structure collections

About this viewer

MolViewer shows 2Y43 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.