Solution structure of human ubiquitin conjugating enzyme Rad6b. Determined by solution NMR. Released 11 May 2011.
Explore 2Y4W in 3D Show helices and sheets RCSB PDB PDBe
2Y4W contains 7 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-18 | 15 | |
| α-helix | 20-21 | 2 | |
| β-strand | 24-27 | 4 | 1 |
| β-strand | 35 | 1 | 1 |
| β-strand | 37-41 | 5 | 1 |
| α-helix | 42-43 | 2 | |
| β-strand | 52-58 | 7 | 1 |
| β-strand | 69-72 | 4 | 1 |
| β-strand | 86 | 1 | 1 |
| α-helix | 90-92 | 3 | |
| α-helix | 103-114 | 12 | |
| α-helix | 124-132 | 9 | |
| α-helix | 134-147 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin-conjugating enzyme E2 B | A | protein | 152 | HOMO SAPIENS | P63146 (AlphaFold model) |
>2Y4W_1 UBIQUITIN-CONJUGATING ENZYME E2 B (chains A) MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS PANSQAAQLYQENKREYEKRVSAIVEQSWNDS
Symmetry and Asymmetry of the Ring-Ring Dimer of Rad18. Huang, A., Hibbert, R.G., Dejong, R.N. et al. J Mol Biol (2011) 410:424. DOI 10.1016/J.JMB.2011.04.051 · PubMed
Other PDB entries of the same protein (UniProt P63146 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2Y4W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.