2Y5C: Adrenodoxin-like protein, mitochondrial

Structure of human ferredoxin 2 (Fdx2)in complex with 2Fe2S cluster. Determined by X-ray diffraction at 1.7 Å resolution. Released 1 Feb 2012.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,880
Mol. weight: 24.44 kDa
Ligands: FES
Released: 1 Feb 2012

Explore 2Y5C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y5C contains 16 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	1
β-strand	17-23	7	1
β-strand	27	1	2
α-helix	28-34	7
β-strand	53-56	4	1
α-helix	57	1
α-helix	58-61	4
α-helix	65-68	4
α-helix	69-76	8
β-strand	85-87	3	1
α-helix	88-90	3
β-strand	92	1	2
α-helix	95-97	3
β-strand	101-103	3	1
α-helix	104-105	2

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	3
β-strand	17-23	7	3
β-strand	27	1	4
α-helix	28-35	8
β-strand	53-56	4	3
α-helix	57	1
α-helix	58-61	4
α-helix	65-68	4
α-helix	69-76	8
β-strand	85-87	3	3
α-helix	88-90	3
β-strand	92	1	4
α-helix	95-97	3
β-strand	101-103	3	3
α-helix	104-105	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adrenodoxin-like protein, mitochondrial	A, B	protein	109	HOMO SAPIENS	Q6P4F2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2Y5C_1 ADRENODOXIN-LIKE PROTEIN, MITOCHONDRIAL (chains A, B)
MASDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDH
LDLLPPPEEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITR

Ligands and cofactors

ID	Name	Formula	Copies
FES	FE2/S2 (inorganic) cluster	Fe2 S2	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure and Functional Studies on Human Mitochondrial Ferredoxins. Webert, H., Hobler, A., Sheftel, A.D. et al. To be published.

Other PDB entries of the same protein (UniProt Q6P4F2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RMC 2.26 Å, Structure of the FDX2-bound core ISC complex (proximal conformation)
8RMF 2.33 Å, Structure of the core ISC complex under turnover conditions (FDX2-bound in proximal…
8RMG 2.46 Å, Structure of the core ISC complex under turnover conditions (FDX2-bound in distal…
8RMD 2.52 Å, Structure of the FDX2-bound core ISC complex (distal conformation)

Browse structure collections

About this viewer

MolViewer shows 2Y5C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.