2Y6W: Bcl-w dimer

Structure of a Bcl-w dimer. Determined by X-ray diffraction at 2.0 Å resolution. Released 26 Oct 2011.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,469
Mol. weight: 39.69 kDa
Released: 26 Oct 2011

Explore 2Y6W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y6W contains 16 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	10-24	15
α-helix	41-70	30
α-helix	72-74	3
α-helix	75-88	14
α-helix	92-112	21
α-helix	117-128	12
α-helix	129-133	5
α-helix	135-140	6
α-helix	143-151	9

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	10-25	16
α-helix	41-67	27
α-helix	74-88	15
α-helix	93-112	20
α-helix	117-132	16
α-helix	135-141	7
α-helix	143-152	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-like protein 2	A, B	protein	177	HOMO SAPIENS	Q92843 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2Y6W_1 BCL-2-LIKE PROTEIN 2 (chains A, B)
MGSHHHHHHGARQMATPASAPDTRALVADFVGYKLRQKGYVSGAGPGEGPAADPLHQAMR
AAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALC
AESVNKEMEPLVGQVQEWMVEYLETRLADWIHSSGGWAEFTALYGDGALEEARRLRE

Primary citation

Crystal Structure of a Bcl-W Domain-Swapped Dimer: Implications for the Function of Bcl-2 Family Proteins. Lee, E.F., Dewson, G., Smith, B.J. et al. Structure (2011) 19:1467. DOI 10.1016/J.STR.2011.07.015 · PubMed

Other PDB entries of the same protein (UniProt Q92843 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CIM 1.5 Å, Complex of a Bcl-w BH3 mutant with a BH3 domain
1MK3 Solution structure of human bcl-W protein
1O0L The structure of bcl-W reveals a role for the C-terminal residues in modulating…
1ZY3 Structural model of complex of Bcl-w protein with Bid BH3-peptide

Browse structure collections

About this viewer

MolViewer shows 2Y6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.