2Y8F: Ran-binding domain from human RanBP3

Structure of the Ran-binding domain from human RanBP3 (wild type). Determined by X-ray diffraction at 2.1 Å resolution. Released 16 Feb 2011.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 4,071
Mol. weight: 62.78 kDa
Released: 16 Feb 2011

Explore 2Y8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y8F contains 5 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	329-344	16	1
β-strand	349-364	16	1
β-strand	370-379	10	1
β-strand	385-390	6	1
β-strand	397-401	5	1
β-strand	404-410	7	1
β-strand	417-423	7	1
α-helix	426-444	19

Chain B: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	331-344	14	2
β-strand	349-362	14	2
β-strand	373-379	7	2
β-strand	385-390	6	2
β-strand	397-401	5	2
β-strand	404-410	7	2
β-strand	417-423	7	2
α-helix	426-449	24

Chain C: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	331-344	14	3
β-strand	349-363	15	3
β-strand	372-379	8	3
β-strand	385-390	6	3
β-strand	397-401	5	3
β-strand	404-411	8	3
β-strand	416-423	8	3
α-helix	426-444	19

Chain D: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	322-325	4
β-strand	331-344	14	4
β-strand	349-363	15	4
β-strand	372-379	8	4
β-strand	385-390	6	4
β-strand	397-401	5	4
β-strand	404-411	8	4
β-strand	416-423	8	4
α-helix	426-453	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ran-binding protein 3	A, B, C, D	protein	138	HOMO SAPIENS	Q9H6Z4 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>2Y8F_1 RAN-BINDING PROTEIN 3 (chains A, B, C, D)
GAMKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVERGRGLLRLNDMASTDDGTLQSRLV
MRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDTEDQGVKVFLISASSKDTGQLYAAL
HHRILALRSRVEQEQEAK

Primary citation

Insights Into the Function of the Crm1 Cofactor Ranbp3 from the Structure of its Ran-Binding Domain. Langer, K., Dian, C., Rybin, V. et al. PLoS One (2011) 6:17011. DOI 10.1371/JOURNAL.PONE.0017011 · PubMed

Other PDB entries of the same protein (UniProt Q9H6Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y8G 1.61 Å, Structure of the Ran-binding domain from human RanBP3 (E352A-R353V double mutant)
5XZX 3.0 Å, Crystal structure of importin-alpha3 bound to the nuclear localization signal of…
2CRF Solution structure of the Ran_BP1 domain of RAN-binding protein-3

Browse structure collections

About this viewer

MolViewer shows 2Y8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.