A39L mutation of scorpion toxin lqh-alpha-it. Determined by X-ray diffraction at 1.08 Å resolution. Released 13 Apr 2011.
Explore 2YEO in 3D Show helices and sheets RCSB PDB PDBe
2YEO contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 1 |
| β-strand | 7 | 1 | 2 |
| β-strand | 8-9 | 2 | 3 |
| β-strand | 13-14 | 2 | 3 |
| α-helix | 15 | 1 | |
| β-strand | 16 | 1 | 1 |
| α-helix | 20-29 | 10 | |
| β-strand | 34-41 | 8 | 1 |
| β-strand | 44-53 | 10 | 1 |
| β-strand | 58 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha-insect toxin lqhait | A | protein | 65 | LEIURUS QUINQUESTRIATUS HEBRAEUS | P17728 (AlphaFold model) |
>2YEO_1 ALPHA-INSECT TOXIN LQHAIT (chains A) MVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWLGKYGNACWCYALPDNVPIRV PGKCR
| ID | Name | Formula | Copies |
|---|---|---|---|
| DR0 | N-(hydroxymethyl)-n,n-dimethylhexan-1-aminium | C9 H22 N O | 1 |
| DR8 | N,n,n-trimethylhepta-1,3,5-triyn-1-aminium | C10 H12 N | 1 |
Water and common crystallization additives (CL, EDO) are not listed.
Crystal Structures of Scorpion Alpha-Toxinsmutants Reveal Conformational Constraints that Dictate Preference for Mammalian Brain Voltage-Gated Na- Channels. Frolow, F., Kahn, R., Gurevitz, M. To be published.
Other PDB entries of the same protein (UniProt P17728 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2YEO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.