2YFW: Histone H3-like centromeric protein CSE4

Heterotetramer structure of Kluyveromyces lactis Cse4,H4. Determined by X-ray diffraction at 2.6 Å resolution. Released 25 May 2011.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: KLUYVEROMYCES LACTIS NRRL Y-1140
Chains: 8
Atoms: 4,822
Mol. weight: 88.73 kDa
Released: 25 May 2011

Explore 2YFW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YFW contains 28 α-helices and 16 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	110-124	15
β-strand	132-133	2	1
α-helix	135-162	28
β-strand	167-168	2	2
α-helix	170-180	11

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	31-40	10
β-strand	45-46	2	2
α-helix	50-75	26
β-strand	80-81	2	1
α-helix	83-93	11

Chain C: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	110-121	12
β-strand	132-133	2	3
α-helix	135-162	28
β-strand	167-168	2	4
α-helix	170-180	11

Chain D: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	31-40	10
β-strand	45-46	2	4
α-helix	49-75	27
β-strand	80-81	2	3
α-helix	83-92	10

Chain E: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	94-101	8
α-helix	110-121	12
β-strand	132-133	2	5
α-helix	135-162	28
β-strand	167-168	2	6
α-helix	170-180	11

Chain F: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	25-28	4
α-helix	31-40	10
β-strand	45-46	2	6
α-helix	50-75	26
β-strand	80-81	2	5
α-helix	83-92	10

Chain G: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	110-124	15
α-helix	130-131	2
β-strand	132-133	2	7
α-helix	135-162	28
β-strand	167-168	2	8
α-helix	170-180	11

Chain H: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	25-28	4
α-helix	31-40	10
β-strand	45-46	2	8
α-helix	50-75	26
β-strand	80-81	2	7
α-helix	83-90	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H3-like centromeric protein CSE4	A, C, E, G	protein	92	KLUYVEROMYCES LACTIS NRRL Y-1140	Q6CTI2 (AlphaFold model)
Histone H4	B, D, F, H	protein	103	KLUYVEROMYCES LACTIS NRRL Y-1140	Q6CMU6 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>2YFW_1 HISTONE H3-LIKE CENTROMERIC PROTEIN CSE4 (chains A, C, E, G)
ALAEIRKYQRSTDLLISRMPFARLVKEVTDQFTTESEPLRWQSMAIMALQEASEAYLVGL
LEHTNLLALHAKRITIMRKDMQLARRIRGQFI

Sequence of entity 2 (B, D, F, H), FASTA

>2YFW_2 HISTONE H4 (chains B, D, F, H)
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRNVLK
TFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG

Primary citation

Recognition of the Centromere-Specific Histone Cse4 by the Chaperone Scm3. Cho, U.S., Harrison, S.C. Proc Natl Acad Sci U S A (2011) 108:9367. DOI 10.1073/PNAS.1106389108 · PubMed

Other PDB entries of the same protein (UniProt Q6CTI2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YFV 2.32 Å, The heterotrimeric complex of Kluyveromyces lactis Scm3, Cse4 and H4

Browse structure collections

About this viewer

MolViewer shows 2YFW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.