2YQL: PHD domain in PHD finger protein 21A

Solution structure of the PHD domain in PHD finger protein 21A. Determined by solution NMR. Released 18 Mar 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 427
Mol. weight: 6.33 kDa
Ligands: ZN
Released: 18 Mar 2008

Explore 2YQL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YQL contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	22-23	2	1
β-strand	30-31	2	1
α-helix	51-54	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 21A	A	protein	56	Homo sapiens	Q96BD5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YQL_1 PHD finger protein 21A (chains A)
GSSGSSGHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Solution structure of the PHD domain in PHD finger protein 21A. He, F., Muto, Y., Inoue, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q96BD5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PUY 1.43 Å, Crystal Structure of the BHC80 PHD finger

Browse structure collections

About this viewer

MolViewer shows 2YQL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.