Solution structure of the fourth Ig-like domain from myosin light chain kinase, smooth muscle. Determined by solution NMR. Released 2 Oct 2007.
Explore 2YR3 in 3D Show helices and sheets RCSB PDB PDBe
2YR3 contains 2 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-16 | 7 | 1 |
| β-strand | 21-23 | 3 | 2 |
| β-strand | 29-32 | 4 | 3 |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 40-42 | 3 | |
| β-strand | 44-47 | 4 | 4 |
| β-strand | 51 | 1 | 4 |
| α-helix | 52 | 1 | |
| β-strand | 58-60 | 3 | 3 |
| β-strand | 63-68 | 6 | 3 |
| β-strand | 77 | 1 | 2 |
| β-strand | 79-84 | 6 | 4 |
| β-strand | 89-93 | 5 | 4 |
| β-strand | 96-98 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin light chain kinase, smooth muscle | A | protein | 99 | Homo sapiens | Q15746 (AlphaFold model) |
>2YR3_1 Myosin light chain kinase, smooth muscle (chains A) GSSGSSGMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCE AGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVH
Solution structure of the fourth Ig-like domain from myosin light chain kinase, smooth muscle. Qin, X.R., Kurosaki, C., Yoshida, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q15746 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2YR3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.