2YRQ: High mobility group protein B1

Solution structure of the tandem HMG box domain from Human High mobility group protein B1. Determined by solution NMR. Released 12 Feb 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,378
Mol. weight: 19.67 kDa
Released: 12 Feb 2008

Explore 2YRQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YRQ contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	22-37	16
α-helix	45-58	14
α-helix	61-77	17
α-helix	79-84	6
α-helix	102-106	5
α-helix	108-123	16
α-helix	129-142	14
α-helix	145-147	3
α-helix	148-170	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
High mobility group protein B1	A	protein	173	Homo sapiens	P09429 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YRQ_1 High mobility group protein B1 (chains A)
GSSGSSGMGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMS
AKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKI
KGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKG

Primary citation

Solution structure of the tandem HMG box domain from Human High mobility group protein B1. Tomizawa, T., Koshiba, S., Watanabe, S. et al. To be published.

Other PDB entries of the same protein (UniProt P09429 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CG9 2.94 Å, Cryo-EM structure of an HMGB1 box bound to nucleosome at SHL-2
6CIK 3.15 Å, Pre-Reaction Complex, RAG1(E962Q)/2-intact/nicked 12/23RSS complex in Mn2+
6CG0 3.17 Å, Cryo-EM structure of mouse RAG1/2 HFC complex (3.17 A)
6CIM 3.6 Å, Pre-Reaction Complex, RAG1(E962Q)/2-nicked/intact 12/23RSS complex in Mn2+
6OEM 3.6 Å, Cryo-EM structure of mouse RAG1/2 PRC complex (DNA0)
6OEO 3.69 Å, Cryo-EM structure of mouse RAG1/2 NFC complex (DNA1)
6CIJ 3.9 Å, Cryo-EM structure of mouse RAG1/2 HFC complex containing partial HMGB1 linker(3.9 A)
6CIL 4.15 Å, Pre-reaction complex, RAG1(E962Q)/2-intact/intact 12/23RSS complex in MN2+
6OEN 4.3 Å, Cryo-EM structure of mouse RAG1/2 PRC complex (DNA1)
8I9M 5.19 Å, The RAGE and HMGB1 complex
2LY4 HMGB1-facilitated p53 DNA binding occurs via HMG-box/p53 transactivation domain…
2RTU Solution structure of oxidized human HMGB1 A box

Browse structure collections

About this viewer

MolViewer shows 2YRQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.