2YUJ: Ubiquitin fusion degradation 1-like

Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1. Determined by solution NMR. Released 15 Apr 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,487
Mol. weight: 21.27 kDa
Released: 15 Apr 2008

Explore 2YUJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YUJ contains 4 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	17-23	7	1
β-strand	42-44	3	1
α-helix	47-55	9
β-strand	63-68	6	1
β-strand	73-81	9	1
β-strand	85	1	2
β-strand	88	1	2
β-strand	89-90	2	1
α-helix	94-99	6
β-strand	105-112	8	1
β-strand	119-124	6	3
α-helix	127-131	5
α-helix	135-143	9
β-strand	148-149	2	4
β-strand	154-158	5	3
β-strand	163-171	9	3
β-strand	177-178	2	4
β-strand	185-188	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin fusion degradation 1-like	A	protein	190	Homo sapiens	Q92890 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YUJ_1 Ubiquitin fusion degradation 1-like (chains A)
GSSGSSGIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITY
PMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYS
KFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSII
ECDMNVDFDA

Primary citation

Solution structure of human ubiquitin fusion degradation protein 1 homolog UFD1. Saito, K., Tomizawa, T., Kigawa, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q92890 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5B6C 1.55 Å, Structural Details of Ufd1 binding to p97
7WWQ 2.72 Å, Crystal structure of human Ufd1-Npl4 complex
9YRC 2.97 Å, p97Ufd1-Npl4 complex processing poly-ubiquitinated substrate in the presence of ATP
5C1B 3.08 Å, p97-delta709-728 in complex with a UFD1-SHP peptide
9YW2 3.27 Å, Complex structure of human p97 bound to Faf1 and Ufd1 (NTD focused)
11TA 3.58 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (motor focused)
11VE 3.85 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (State1)
11SY 4.28 Å, Cryo-EM structure of substrate engaged p97-Ufd1-NPL4-Faf1 complex (NPL4 focused)

Browse structure collections

About this viewer

MolViewer shows 2YUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.