Solution structure of the SANT domain of human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1. Determined by solution NMR. Released 8 Apr 2008.
Explore 2YUS in 3D Show helices and sheets RCSB PDB PDBe
2YUS contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23-35 | 13 | |
| α-helix | 40-47 | 8 | |
| α-helix | 52-59 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 | A | protein | 79 | Homo sapiens | Q92922 (AlphaFold model) |
>2YUS_1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1 (chains A) GSSGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFL RLPIEDPYLENSDSGPSSG
Solution structure of the SANT domain of human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1. Tochio, N., Koshiba, S., Satio, K. et al. To be published.
Other PDB entries of the same protein (UniProt Q92922 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2YUS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.