2Z3Q: IL-15/IL-15Ra complex

Crystal structure of the IL-15/IL-15Ra complex. Determined by X-ray diffraction at 1.85 Å resolution. Released 4 Sept 2007.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,263
Mol. weight: 49.51 kDa
Released: 4 Sept 2007

Explore 2Z3Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Z3Q contains 24 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1-16	16
β-strand	25-27	3	1
α-helix	33-35	3
α-helix	36-54	19
α-helix	57-71	15
α-helix	85-87	3
α-helix	88-90	3
β-strand	92-94	3	1
α-helix	96-110	15

Chain B: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	2
α-helix	6-8	3
β-strand	12-13	2	3
β-strand	20	1	2
β-strand	24-26	3	4
β-strand	28-29	2	3
α-helix	30	1
β-strand	33-35	3	5
α-helix	36	1
β-strand	42-44	3	4
β-strand	45-48	4	6
β-strand	53-56	4	6
α-helix	57-59	3
β-strand	63-65	3	5
α-helix	67-72	6

Chain C: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1-15	15
β-strand	25-26	2	7
α-helix	36-54	19
α-helix	57-75	19
α-helix	85-87	3
α-helix	88-90	3
α-helix	92	1
β-strand	93-94	2	7
α-helix	96-110	15

Chain D: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	8
α-helix	5-8	4
β-strand	12-14	3	9
β-strand	20	1	8
β-strand	24-26	3	10
β-strand	27-29	3	9
α-helix	30	1
β-strand	33-35	3	11
α-helix	36	1
β-strand	42-44	3	10
β-strand	45-48	4	12
β-strand	53-56	4	12
α-helix	57-59	3
β-strand	63-65	3	11
α-helix	67-70	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-15	A, C	protein	119	Homo sapiens	P40933 (AlphaFold model)
Interleukin-15 receptor alpha chain	B, D	protein	107	Homo sapiens	Q13261 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2Z3Q_1 Interleukin-15 (chains A, C)
AMAISNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESG
DASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Sequence of entity 2 (B, D), FASTA

>2Z3Q_2 Interleukin-15 receptor alpha chain (chains B, D)
AMAISITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAH
WTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAAS

Primary citation

Crystal structure of the IL-15-IL-15Ralpha complex, a cytokine-receptor unit presented in trans. Chirifu, M., Hayashi, C., Nakamura, T. et al. Nat Immunol (2007) 8:1001-1007. DOI 10.1038/ni1492 · PubMed

Other PDB entries of the same protein (UniProt P40933 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Z3R 2.0 Å, Crystal structure of the IL-15/IL-15Ra complex
4GS7 2.35 Å, Structure of the Interleukin-15 quaternary complex
2XQB 2.6 Å, Crystal Structure of anti-IL-15 Antibody in Complex with human IL-15

Browse structure collections

About this viewer

MolViewer shows 2Z3Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.