2Z3R: IL-15/IL-15Ra complex
Crystal structure of the IL-15/IL-15Ra complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 Sept 2007.
- Method
- X-ray diffraction
- Resolution
- 2.0 Å
- Organism
- Homo sapiens
- Chains
- 16
- Atoms
- 12,517
- Mol. weight
- 198.4 kDa
- Released
- 4 Sept 2007
Explore 2Z3R in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2Z3R contains 101 α-helices and 96 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-16 | 16 | |
| β-strand | 25-27 | 3 | 1 |
| α-helix | 33-35 | 3 | |
| α-helix | 36-54 | 19 | |
| α-helix | 57-75 | 19 | |
| α-helix | 85-87 | 3 | |
| α-helix | 88-90 | 3 | |
| β-strand | 92-94 | 3 | 1 |
| α-helix | 96-110 | 15 | |
Chain B: 6 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2 | 1 | 2 |
| α-helix | 5-8 | 4 | |
| β-strand | 12-13 | 2 | 3 |
| β-strand | 20 | 1 | 2 |
| β-strand | 24-26 | 3 | 4 |
| β-strand | 28-29 | 2 | 3 |
| α-helix | 30 | 1 | |
| β-strand | 33-35 | 3 | 5 |
| α-helix | 36 | 1 | |
| β-strand | 42-44 | 3 | 4 |
| β-strand | 45-48 | 4 | 6 |
| α-helix | 49-51 | 3 | |
| β-strand | 53-56 | 4 | 6 |
| α-helix | 57-59 | 3 | |
| β-strand | 63-65 | 3 | 5 |
| α-helix | 67-70 | 4 | |
Chain C: 7 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -3-15 | 19 | |
| β-strand | 25-27 | 3 | 7 |
| α-helix | 33-35 | 3 | |
| α-helix | 36-54 | 19 | |
| α-helix | 57-74 | 18 | |
| α-helix | 85-87 | 3 | |
| α-helix | 88-90 | 3 | |
| β-strand | 92-94 | 3 | 7 |
| α-helix | 96-113 | 18 | |
Chain D: 5 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2 | 1 | 8 |
| α-helix | 6-8 | 3 | |
| β-strand | 12-14 | 3 | 9 |
| β-strand | 20 | 1 | 8 |
| β-strand | 24-26 | 3 | 10 |
| β-strand | 27-29 | 3 | 9 |
| α-helix | 30 | 1 | |
| β-strand | 33-35 | 3 | 11 |
| α-helix | 36 | 1 | |
| β-strand | 42-44 | 3 | 10 |
| β-strand | 45-47 | 3 | 12 |
| β-strand | 54-56 | 3 | 12 |
| α-helix | 57-59 | 3 | |
| β-strand | 63-65 | 3 | 11 |
| α-helix | 66 | 1 | |
Chain E: 7 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | -2-16 | 19 | |
| β-strand | 24-27 | 4 | 13 |
| α-helix | 33-35 | 3 | |
| α-helix | 36-54 | 19 | |
| α-helix | 57-75 | 19 | |
| α-helix | 85-87 | 3 | |
| α-helix | 88-90 | 3 | |
| β-strand | 92-95 | 4 | 13 |
| α-helix | 96-113 | 18 | |
Chain F: 6 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2 | 1 | 14 |
| α-helix | 5-8 | 4 | |
| β-strand | 12-14 | 3 | 15 |
| β-strand | 20 | 1 | 14 |
| β-strand | 24-26 | 3 | 16 |
| β-strand | 27-29 | 3 | 15 |
| α-helix | 30 | 1 | |
| β-strand | 33-35 | 3 | 17 |
| α-helix | 36 | 1 | |
| β-strand | 42-44 | 3 | 16 |
| β-strand | 45-48 | 4 | 18 |
| α-helix | 49-51 | 3 | |
| β-strand | 53-56 | 4 | 18 |
| α-helix | 57-59 | 3 | |
| β-strand | 63-65 | 3 | 17 |
| α-helix | 67-70 | 4 | |
Chain G: 7 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-16 | 16 | |
| β-strand | 25-27 | 3 | 19 |
| α-helix | 33-35 | 3 | |
| α-helix | 36-54 | 19 | |
| α-helix | 57-74 | 18 | |
| α-helix | 85-87 | 3 | |
| α-helix | 88-90 | 3 | |
| β-strand | 92-94 | 3 | 19 |
| α-helix | 96-110 | 15 | |
Chain H: 6 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2 | 1 | 20 |
| α-helix | 5-8 | 4 | |
| β-strand | 12-13 | 2 | 21 |
| β-strand | 20 | 1 | 20 |
| β-strand | 24-26 | 3 | 22 |
| β-strand | 28-29 | 2 | 21 |
| α-helix | 30 | 1 | |
| β-strand | 33-35 | 3 | 23 |
| α-helix | 36 | 1 | |
| β-strand | 42-44 | 3 | 22 |
| β-strand | 45-47 | 3 | 24 |
| β-strand | 54-56 | 3 | 24 |
| α-helix | 57-59 | 3 | |
| β-strand | 63-65 | 3 | 23 |
| α-helix | 66 | 1 | |
| α-helix | 67-70 | 4 | |
8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Interleukin-15 | A, C, E, G, I, K, M, O | protein | 119 | Homo sapiens | P40933 (AlphaFold model) |
| Interleukin-15 receptor alpha chain | B, D, F, H, J, L, N, P | protein | 107 | Homo sapiens | Q13261 (AlphaFold model) |
Sequence of entity 1 (A, C, E, G, I, K, M, O), FASTA
>2Z3R_1 Interleukin-15 (chains A, C, E, G, I, K, M, O)
AMAISNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESG
DASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Sequence of entity 2 (B, D, F, H, J, L, N, P), FASTA
>2Z3R_2 Interleukin-15 receptor alpha chain (chains B, D, F, H, J, L, N, P)
AMAISITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAH
WTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAAS
Primary citation
Crystal structure of the IL-15-IL-15Ralpha complex, a cytokine-receptor unit presented in trans. Chirifu, M., Hayashi, C., Nakamura, T. et al. Nat Immunol (2007) 8:1001-1007. DOI 10.1038/ni1492 · PubMed
Other PDB entries of the same protein (UniProt P40933 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2Z3Q 1.85 Å, Crystal structure of the IL-15/IL-15Ra complex
- 4GS7 2.35 Å, Structure of the Interleukin-15 quaternary complex
- 2XQB 2.6 Å, Crystal Structure of anti-IL-15 Antibody in Complex with human IL-15
Browse structure collections
About this viewer
MolViewer shows 2Z3R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.